KEGG   Sinocyclocheilus anshuiensis: 107666197
Entry
107666197         CDS       T04917                                 

Definition
(RefSeq) serine/threonine-protein kinase NLK
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04068  FoxO signaling pathway
sanh04310  Wnt signaling pathway
sanh04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107666197
   04310 Wnt signaling pathway
    107666197
   04068 FoxO signaling pathway
    107666197
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107666197
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107666197
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107666197
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107666197
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH FTA2
Other DBs
NCBI-GeneID: 107666197
NCBI-ProteinID: XP_016312882
LinkDB
Position
Unknown
AA seq 448 aa
MLNPSQQQPYFPSPAPGQAPGPAAAAAPAQVQAAAAAAVKAHHHHHHQHSHHLQQQLDIE
PDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHDNVLS
ALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYLHSAG
ILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGSRHYS
NAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGARAHILRG
PHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMC
KCCYTTSSGRVYTSDFEPVTNPKFDDGFEKNLTSVRQVKEIIHQFILEQQKGNRVPLCIN
PQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgctgaacccgagccagcagcagccgtacttcccctcgcctgctcctggacaagccccg
gggccggcggccgctgcagccccagcgcaagttcaagccgccgccgcggccgctgtgaag
gcgcatcatcaccaccaccaccaacactcgcatcacttacaacaacagctggatatagag
ccggacagaccgatcggatacggagctttcggtgtggtttggtcagtgacagaccccaga
gacggcaaacgcgtggccctcaaaaagatgcccaatgtcttccaaaacctcgtctcctgc
aagagggttttccgcgagctgaagatgctttgtttcttcaagcacgacaatgtgctgtca
gctctggatattctgcagcctccacacatcgactactttgaggaaatttatgtagtgacg
gagttgatgcagagtgacctccataagatcatcgtgtctccacagcccctaagctctgac
cacgtcaaagtctttctctaccagatcctccgaggattgaagtatctacactcagctggc
attttgcacagagacattaaacccggtaacctgttggtcaacagcaattgtgtgctaaag
atatgtgactttggcctggcaagagtggaggagctggacgagtcacgtcacatgacccag
gaggtggtgacgcagtactacagagcaccagagatcctgatggggagcaggcactattcc
aatgccatcgacatctggtctgtgggctgcatatttgctgagctgcttggccgacgcatc
ctcttccaggcccagagtcccatccaacagctggacttaatcacagatctgctggggact
ccgtcactggaggccatgaggacggcgtgtgagggggccagagctcacatcctgagagga
ccacataaacagccctcacttcctgtcctgtacactctgtccagtcaagcaacccatgag
gccgttcacctcctctgcaggatgttggtctttgacccatcgaagcggatctctgcaaag
gacgccctggcgcacccgtatctggatgaggggcgtctgcggtaccacacctgcatgtgc
aaatgttgctacaccacgtcctctggccgcgtctacaccagtgactttgagcctgtcacc
aaccccaagtttgacgacggctttgagaagaacctgacgtcagttcggcaggtcaaagag
atcattcatcagttcatcctggagcagcagaaggggaatcgggtaccgctttgtatcaac
ccccaatcagctgccttcaaaagctttatcagctcaacagtagctcagccctctgagatg
cctccatctcctctggtttgggagtag

KEGG   Sinocyclocheilus anshuiensis: 107678874
Entry
107678874         CDS       T04917                                 

Definition
(RefSeq) serine/threonine-protein kinase NLK2-like
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04068  FoxO signaling pathway
sanh04310  Wnt signaling pathway
sanh04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107678874
   04310 Wnt signaling pathway
    107678874
   04068 FoxO signaling pathway
    107678874
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107678874
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107678874
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107678874
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107678874
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH FTA2
Other DBs
NCBI-GeneID: 107678874
NCBI-ProteinID: XP_016329783
UniProt: A0A671NYE8
LinkDB
Position
Unknown
AA seq 475 aa
MAFHGSSRPTVCGNLFPGSELGHKYFCVNTTTGTTSTGLSATPNPTGPNAPAGTPRHPAS
LGGSTGGGAAIPQPHSNPASEVPSPAEMEPDRPIGYGAFGVVWSVTDPRDGRKVALKKMP
NVFQNLVSCKRVFRELRMLCFFKHDNVLSALDILQPPQIDCFEEIYVITELMQSDLHKVI
VSPQPLTTDHIKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCLLKICDFGLARVEE
PDPSRHMTQEVVTQYYRAPEVLMGCHHYTSSIDVWSVGCIFAELLGRRILFQAQSPIQQL
DLITDLLGTPPLSAMASACEGARAHILRGPHKPPSLSVLYMLSDGATHEAVHLLCRMLVF
DPAKRISGSDALSHPYLDEGRLRYHTCMCKCCYSVPSGRVYTRDFEPPADRPFSHNYEQS
MHSVWQGKELIHRFITEHQQGKRVPLCINPQSAAFKTFIRSTAWHSSKVSRKEER
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggctttccatggatcctctcggccaacagtgtgtggtaacttgttccctggatcagag
ttaggccacaagtatttttgtgtcaacaccacgaccggcactacctcaacgggcctcagc
gctacaccaaatccgaccggacccaacgcacctgctgggactcccaggcacccggcgtct
ctcgggggcagcacaggcggaggggcggccatcccgcaacctcacagtaacccagcaagt
gaggttccaagtcctgctgaaatggagcccgatcggcctatcggttatggtgcgtttgga
gtggtctggtctgtgacagaccctcgggatggacgtaaggtggctctgaagaaaatgccg
aatgtcttccagaacctggtctcctgcaaacgtgtgttcagggaactccggatgctgtgt
ttctttaaacatgacaatgtgctgtctgcccttgacattctccaacctccacaaatcgac
tgctttgaggagatatacgtgatcactgagctcatgcagagtgacctacataaagtcatc
gtttcccctcagcctctcaccaccgatcatatcaaggtgtttctctaccagatactcagg
gggctgaagtacctgcattctgcaggcattctgcacagagacatcaaaccagggaacctg
ctggtcaacagcaactgtctgcttaagatttgtgactttggcctggcgcgagtggaggaa
ccggatccttctcgtcacatgacccaggaggtggtgacgcagtattaccgtgctccggag
gttctgatgggatgccaccattacacttcgtcgatagatgtctggtctgtaggctgcatc
ttcgcagagttgctgggcagacgtattcttttccaggctcagagccccatacaacagttg
gatctgatcactgatctcctcgggactcctcctctttctgccatggcatccgcgtgtgaa
ggagcgcgagcgcatattcttagaggaccccacaaaccaccctcgctttctgttctgtac
atgttgtcagatggggcaacacatgaagctgttcatcttttgtgccgcatgctagttttt
gatccagccaagcgcatctcgggcagtgacgctctgtcacatccgtacttggatgagggt
cgtctgcggtaccacacctgcatgtgtaagtgctgctactctgtgcccagcgggagggtg
tacacccgagactttgagccgcctgcggatcgacctttcagtcacaactatgagcagagc
atgcactccgtctggcagggcaaagagctcattcatcgttttataacagagcaccagcaa
ggcaaacgagtgcctttgtgcatcaatccccagagtgcagccttcaaaaccttcattaga
tccacagcctggcattcttcaaaagtatcaaggaaagaagagagatga

KEGG   Sinocyclocheilus anshuiensis: 107682651
Entry
107682651         CDS       T04917                                 

Definition
(RefSeq) serine/threonine-protein kinase NLK-like
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04068  FoxO signaling pathway
sanh04310  Wnt signaling pathway
sanh04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107682651
   04310 Wnt signaling pathway
    107682651
   04068 FoxO signaling pathway
    107682651
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107682651
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107682651
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107682651
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107682651
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like FTA2
Other DBs
NCBI-GeneID: 107682651
NCBI-ProteinID: XP_016334314
LinkDB
Position
Unknown
AA seq 515 aa
MALCGTTASNAAKMMAAYNGGTAAVAAHHPHHHHQLPHLPPPAHLHHHHHPGQHHLQHPG
SVAAAAVMLNPSQQQPYFPSPAPGQAPGPAAAAAPAQVQAAAAAAVKAHHHHHHQHSHHL
QQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFF
KHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGL
KYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEIL
MGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGA
RAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRL
RYHTCMCKCCYTTSSGRVYTSDFEPVTNPKFDDGFEKNLTSVRQVKEIIHQFILEQQKGN
RVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggctctgtgcggaacgacggcttccaatgccgcgaaaatgatggctgcgtacaacggc
ggcaccgcggcagtggcagcgcatcacccgcaccatcaccaccagctgccccatctcccg
ccacccgcccacctccaccaccatcaccacccgggccagcatcacctccagcaccccggc
tcggttgccgcggcggcggtgatgctgaacccgagccagcagcagccgtacttcccctcg
cccgctcctggacaagctccggggccggcggccgctgcagccccagcgcaagttcaagcc
gccgccgcggccgctgtgaaggcgcatcatcaccaccaccaccaacactcgcatcactta
caacaacagctggatatagagccggacagaccgatcggatacggagctttcggtgtggtt
tggtcagtgacagaccccagagacggcaaacgcgtggccctcaaaaagatgcccaatgtc
ttccaaaacctcgtctcctgcaagagggttttccgtgagctgaagatgctttgtttcttc
aagcacgacaatgtgctgtcagctctggatattctgcagcctccacacatcgactacttt
gaggaaatttatgtggtgacggagttgatgcagagtgacctccataagatcatcgtgtct
ccacagcccctgagctctgaccacgtcaaagtctttctctaccagatcctccgaggactg
aagtatctacactcagctggcattttgcacagagacattaaacctggtaacctgttggtc
aacagcaactgtgtgcttaagatttgtgactttggcctggcaagagtggaggagctggac
gagtcgcgtcacatgacccaggaggtggtgacgcagtactacagagcgccagagatcctg
atggggagcaggcactattccaacgccatcgacatctggtctgtgggctgcatctttgcc
gagctgcttggccgacgcatcctcttccaggctcagagtcccatccaacagctggacttg
atcacagatctgctggggactccgtctctggaggccatgaggacggcgtgtgagggggcc
agagctcacatcctgagaggaccacataaacagccctcacttcctgtcctgtacactctg
tccagtcaagcaacccatgaggccgttcacctcctgtgcaggatgctggtctttgaccca
tcgaagcggatctctgcaaaagatgcactggcacacccatatctggacgaggggcgtctg
cggtaccacacctgcatgtgcaaatgctgctacaccacttcctctggccgcgtctacacc
agtgactttgagcctgtcactaaccccaagtttgatgacggctttgagaaaaacctgacg
tcagttcggcaggtcaaagagatcattcatcagttcatcctggagcagcagaaggggaat
cgggtaccgctctgtatcaacccccaatcagctgccttcaaaagctttatcagctcaaca
gtagctcagccctctgagatgcctccatctcctctagtttgggagtag

KEGG   Sinocyclocheilus anshuiensis: 107684639
Entry
107684639         CDS       T04917                                 

Definition
(RefSeq) serine/threonine-protein kinase NLK2-like
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04068  FoxO signaling pathway
sanh04310  Wnt signaling pathway
sanh04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107684639
   04310 Wnt signaling pathway
    107684639
   04068 FoxO signaling pathway
    107684639
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107684639
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107684639
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107684639
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107684639
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH FTA2
Other DBs
NCBI-GeneID: 107684639
NCBI-ProteinID: XP_016336426
LinkDB
Position
Unknown
AA seq 475 aa
MAFHGSSRPTVCGNLFPGSDLGHKYFCVNTTTGTTSTGLSATPNPTGPNAPAGTPRHPAS
LGGSAGGGAAIPQPHSNPASEVPSPXEMEPDRPIGYGAFGVVWSVTDPRDGRKVALKKMP
NVFQNLVSCKRVFRELRMLCFFKHDNVLSALDILQPPQIDCFEEIYVITELMQSDLHKVI
VSPQPLTTDHIKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCLLKICDFGLARVEE
PDPSRHMTQEVVTQYYRAPEVLMGCQHYTSSIDVWSVGCIFAELLGRRILFQAQSPIQQL
DLITDLLGTPPLPAMASACEGARVHILRGPHKPPSLSVLYMLSDGATHEAVHLLCRMLVF
DPAKRISGSDALSHPYLDEGRLRYHTCMCKCCYSVPSGRVYTRDFEPPADRPFSHNYEQS
MHSVWQGKELIHRFITEHQQGKRVPLCINPQSAAFKTFIRSTAWHSSKVSRKEER
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggctttccatggatcctctcggccaacagtgtgtggtaacttgttccctggatcagac
ttaggccacaagtatttttgtgtcaacaccacgaccggcactacctcaacgggcctcagc
gcaacaccaaatccgactggacccaacgctcccgctgggactcccagacacccggcgtct
ctcgggggcagcgcaggcggaggtgcggccatcccacaacctcacagtaacccagcaagt
gaggttccaagtcctnctgaaatggagcctgatcggcctatcggttatggtgcatttggg
gtggtctggtctgtgacggaccctcgggatggacgtaaggtggctctgaagaaaatgccg
aatgtcttccagaacctggtctcctgcaaacgtgtgttcagggaactccggatgctgtgt
ttctttaaacacgacaatgtgctgtctgcccttgacattctccaacctccacaaatcgac
tgctttgaggagatatacgtgatcactgagctcatgcagagtgacctacataaagtcatc
gtttcccctcagcctctcaccaccgatcacatcaaggtgttcctctaccagatactcagg
gggctgaagtacctgcattctgcaggcattctgcacagagacatcaaaccagggaacctg
ctggtcaacagcaactgtctgctaaagatttgtgactttggcctggcgcgagtggaggag
ccggatccttctcgtcacatgacccaggaggtggtgacgcagtattaccgtgctccagag
gttctgatgggatgccagcattacacttcatctatagatgtctggtctgtaggctgcatc
ttcgcagagttgctgggcagacgtattcttttccaggctcagagccccatacaacagttg
gatctgatcactgatctcctcgggactcctcctcttcctgccatggcatccgcgtgtgaa
ggagcacgagtgcacattcttagaggaccccacaaaccaccctcgctgtctgttctgtac
atgttgtcagatggagcaacacatgaagctgttcatcttttgtgccgcatgctagttttt
gatccagctaagcgcatctcgggcagtgatgctctgtctcatccatatttggatgagggt
cgtctgcggtaccacacctgcatgtgtaagtgctgttactctgtgcccagcgggagggtg
tacacccgagactttgagccgcctgcggatcgacctttcagccacaactatgagcagagc
atgcactccgtctggcagggcaaagagctcatccatcgttttataacagagcaccagcaa
ggcaagcgagtgcctttgtgcatcaatccccagagtgcagccttcaaaaccttcattaga
tccacagcctggcattcctcaaaagtatcaaggaaagaagagagatga

DBGET integrated database retrieval system