KEGG   Sinocyclocheilus anshuiensis: 107666430
Entry
107666430         CDS       T04917                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04620  Toll-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107666430
   04012 ErbB signaling pathway
    107666430
   04370 VEGF signaling pathway
    107666430
   04371 Apelin signaling pathway
    107666430
   04068 FoxO signaling pathway
    107666430
   04150 mTOR signaling pathway
    107666430
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107666430
  09143 Cell growth and death
   04210 Apoptosis
    107666430
   04218 Cellular senescence
    107666430
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107666430
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107666430
   04625 C-type lectin receptor signaling pathway
    107666430
  09152 Endocrine system
   04910 Insulin signaling pathway
    107666430
   04920 Adipocytokine signaling pathway
    107666430
   04914 Progesterone-mediated oocyte maturation
    107666430
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107666430
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107666430
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107666430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107666430
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107666430
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107666430
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C FTA2 APH
Other DBs
NCBI-GeneID: 107666430
NCBI-ProteinID: XP_016313232
UniProt: A0A671S2P9
LinkDB
Position
Unknown
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTLEERDEWAEAIQMVADKLQRQEEERIQCS
PTSQIDNMGEEEMDTSISHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFAGIDWQDVYDKKLIP
PFKPQVSSETDTRYFDEEFTAQTITITPPEKFDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgtcaccatcgttaaggaaggctgggtccagaagagaggtgaatatattaag
aattggagacctcgctacttcctgctaaaaaccgatgggtcctttatcggatacaaggag
aagccacaggatgcagatcttccctaccctctcaataacttctctgttgcaaaatgccag
ctgatgaaaactgaacgaccaaagccgaacacttttattattagatgtctacaatggact
acagtcatagagaggaccttccatgtggacacgctagaagagagggatgagtgggcagag
gcgatccagatggtggcagataaactccaaagacaggaagaggaacgtatccagtgtagt
cccacctcacagatagacaacatgggagaggaggagatggacacatctatcagccatcac
aaacgcaagacaatgaatgactttgactacttaaaattattgggaaaaggcacttttgga
aaagtcattctcgtacgggagaaggccagcgggaaatattatgcaatgaaaattttaaag
aaagaggttattatagccaaggacgaagtggcccacacgcttacagaaagcagagtacta
aaaaacacgagacatccttttttaacctctttgaagtactcgttccaaacaaaagaccgc
ctatgcttcgtgatggagtatgtcaatggaggagagctgtttttccatttgtcgagagaa
cgggtgttctccgaggaccgcacgcgcttctacggcgccgagatcgtttccgccctcgac
tacctgcactctgccaagattgtgtaccgggatctcaagctggagaacttgatgcttgat
aaagatggtcacatcaaaattacagactttggcctctgcaaggaaggaatcactgatgct
gctaccatgaagaccttctgtgggacgccagagtatctggcaccagaggtgctggaggac
aatgattacggccgtgcggtggactggtggggtctcggtgtggtcatgtatgagatgatg
tgtggccgactgcctttctacaatcaggaccatgagaagctctttgagctcatcctaatg
gaggacatcaagttccccaggacgctctctgctgacgccaagtccctactgtcaggcctg
ctcatcaaagatcccaataagagacttggtggaggtccagatgatgcaaaagaaattatg
cgacatagtttctttgcgggaattgactggcaggatgtctatgataaaaagctgatacct
cccttcaagcctcaggtgtcgtcagagacagataccagatatttcgatgaagagttcaca
gctcagacgattacaataacccctcctgaaaaattcgatgaagatgggatggattgcatg
gacaacgagcgacgaccacacttcccccagttctcctactccgccagcgggagagagtga

KEGG   Sinocyclocheilus anshuiensis: 107670243
Entry
107670243         CDS       T04917                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04620  Toll-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107670243
   04012 ErbB signaling pathway
    107670243
   04370 VEGF signaling pathway
    107670243
   04371 Apelin signaling pathway
    107670243
   04068 FoxO signaling pathway
    107670243
   04150 mTOR signaling pathway
    107670243
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107670243
  09143 Cell growth and death
   04210 Apoptosis
    107670243
   04218 Cellular senescence
    107670243
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107670243
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107670243
   04625 C-type lectin receptor signaling pathway
    107670243
  09152 Endocrine system
   04910 Insulin signaling pathway
    107670243
   04920 Adipocytokine signaling pathway
    107670243
   04914 Progesterone-mediated oocyte maturation
    107670243
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107670243
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107670243
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107670243
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107670243
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107670243
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107670243
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 Pkinase_fungal FTA2 Seadorna_VP7 APH
Other DBs
NCBI-GeneID: 107670243
NCBI-ProteinID: XP_016318266
LinkDB
Position
Unknown
AA seq 473 aa
MSDVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQC
QLMKTERPKANTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQAVADSLQKQEEERMDS
SPDPMDMEMYLSKPRLKVTMHDFEYLKLLGKGTFGKVILVKEKATGKYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTRDRLCFVMEYANGGELFFHLSRDRVFSE
ERAQFYGAEIVSALDYLHSERNIVYRDLKLENLMLDKDGHIKITDFGLCKEGITEGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMDEIR
FPRTLGPEAKSLLSGLLQKDPKQRLGGGPDDAKEIMQHKFFAGIEWQGVYEKKLVPPFKP
QVTSETDTRYFDVEFTGQTITITPPGQDENMESFDSDRRPHFPQFSYSASGTA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgagtgatgttgtcattgtgaaggagggatggctacataagagaggagaatacataaaa
acatggagaccaagatatttcttactcaagagtgatggaacatttattgggtacaaagag
cggccacaagatgttgaccagctggaaactccactcaataacttttcagtggcccaatgt
cagctgatgaagacagagcgaccgaaggcaaacacttttattattcggtgcctgcagtgg
actactgttattgaacgcacttttcatgttgagaccccagaggaaagggaggagtggacg
aaggccatccaggctgtggcagatagtctacagaagcaggaggaagagagaatggactct
tcacccgaccctatggacatggagatgtacctgtccaaacctcggctcaaagtgacaatg
catgactttgaatacctcaaactcttggggaaaggcacttttggaaaggtcatactggtg
aaggagaaagccacaggaaaatactatgccatgaaaattcttaaaaaggaggttatagta
gcaaaagatgaggtagcacacacacttactgaaaaccgggtcctccagaactccaaacac
ccttttttaacaggtctgaagtattctttccagactcgtgaccgattatgttttgttatg
gagtatgcaaatggtggagagcttttctttcatttatcgcgagatcgcgttttttcggaa
gagagagcacagttttatggagcagagattgtctcagccctggattaccttcattctgag
agaaacattgtttatagagacttaaagttggagaacttgatgctggataaagatggccac
ataaagatcactgattttggcctgtgcaaggagggaattacagagggagcaacaatgaag
acgttctgcggtacaccagagtatctggctccagaggttcttgaggacaatgattatggc
cgggcggtggactggtgggggttgggtgtagtcatgtacgagatgatgtgcggccggctg
cccttctacaaccaggatcatgagaaactctttgaattgatcctcatggatgagatccgt
tttcctcgtacacttggacctgaggcaaaatctttgctgtcaggactgcttcagaaagac
ccaaagcagcggttaggtggaggtccagatgatgcaaaagaaatcatgcagcataagttc
tttgcaggcattgagtggcaaggtgtttatgagaagaagcttgtaccaccctttaagccc
caggtaacctcagaaacagacactcgctattttgatgtggagtttacagggcagaccatc
accatcacacccccaggccaagatgaaaacatggagtccttcgacagtgatagaagaccc
cacttccctcaattctcatattctgccagtggcacagcataa

KEGG   Sinocyclocheilus anshuiensis: 107671613
Entry
107671613         CDS       T04917                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04620  Toll-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107671613
   04012 ErbB signaling pathway
    107671613
   04370 VEGF signaling pathway
    107671613
   04371 Apelin signaling pathway
    107671613
   04068 FoxO signaling pathway
    107671613
   04150 mTOR signaling pathway
    107671613
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107671613
  09143 Cell growth and death
   04210 Apoptosis
    107671613
   04218 Cellular senescence
    107671613
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107671613
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107671613
   04625 C-type lectin receptor signaling pathway
    107671613
  09152 Endocrine system
   04910 Insulin signaling pathway
    107671613
   04920 Adipocytokine signaling pathway
    107671613
   04914 Progesterone-mediated oocyte maturation
    107671613
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107671613
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107671613
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107671613
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107671613
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107671613
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107671613
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 N2227 Seadorna_VP7
Other DBs
NCBI-GeneID: 107671613
NCBI-ProteinID: XP_016320008
LinkDB
Position
Unknown
AA seq 469 aa
MTEVSVVKEGWLYKRGEYIKTWRPRYFILKSDGSFMGYKEKPELTDQSSAPLNNFSVEEC
QLMKTERPRPNTFMIRCLQWTSVIERTFHVESSEERDEWMRAIQAVANGLQAREADEPME
IKYSSPGDVCGLEDMEVSLSKSSSRVTMNDFDYLKLLGKGTFGKVILVREKASGVYYAMK
ILRKEVIIAKVTDSLLTNPIPTLKYAFQTPDRLCFVMEYANGGELFFHLSRERVFSEDRA
RFYGAEIVSALNYLHSQNVVYRDLKLENLMLDKDGHMKITDFGLCKEGITDEATMRTFCG
TPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELIVMEEIRFPKN
LSPEAKALLTGLLRKDPKQRLGGGADDAREVMGHKFFSGIHWEDVLQKKLVPPFKPQVTS
ETDTRYFDDEFTAQSITVTPPDKQSRQDVEDAGPVAHFPQFSYSASIRE
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgacggaggtcagcgtggtgaaggaaggctggctctataaacgaggtgagtacatcaag
acctggaggccgcgctacttcatcctgaagagtgacggatccttcatgggctataaggag
aagccggagctaacggatcagagctcggctccgctcaataatttctctgtggaagagtgt
cagctgatgaagaccgagcgtccgcggccaaacaccttcatgatccgctgcctgcagtgg
acgagcgtcatcgagagaaccttccacgtggagagcagcgaggagagggacgagtggatg
cgtgcgatccaggccgtggccaatgggctgcaggcgcgggaagcggacgaaccgatggag
atcaagtacagctctcccggtgacgtctgcggtctggaggacatggaggtgtctctgtcc
aaatccagctccagagtgacgatgaatgacttcgattacctgaagctgctgggtaaaggc
acgtttgggaaggtgattctggtgcgagagaaagcctcgggggtgtactacgccatgaag
atcctgcggaaggaagtcatcatcgctaaggtgacagactctttactaaccaacccgatt
ccaactcttaaatatgccttccagacccctgaccggctgtgttttgtgatggagtatgct
aacggaggagagctgttcttccatctgtcccgtgagcgtgtcttctctgaggacagagcg
cgcttctacggcgctgagatcgtctccgctctcaactatctgcactcacagaacgtcgtc
tacagggacctgaagctggagaacctcatgctggataaagacggacatatgaagatcaca
gactttggtctctgtaaggagggaatcacagatgaggccaccatgagaacgttctgtgga
accccagaataccttgcgccggaggtgctggaggacaatgattacggccgcgcagtggac
tggtggggtctgggagtggtgatgtacgagatgatgtgcggacgcttgcccttctacaat
caggaccacgagcggctcttcgagctcatcgtgatggaggagatccgtttccccaagaac
ctctcgcctgaagccaaagcgctgctcaccggcctgctgaggaaagaccccaaacagagg
ctcggaggcggagctgatgacgccagagaagtgatggggcacaagttcttctccggtatt
cactgggaagatgtgctgcagaagaagctggtgccgccctttaaaccgcaggtgacgtca
gagacggacacacgctactttgacgatgagttcacagcgcagagcatcactgttacaccg
ccagacaagcagagccgtcaggatgtggaggacgctgggccggtcgctcacttccctcag
ttctcttactccgccagcatacgagagtga

KEGG   Sinocyclocheilus anshuiensis: 107676708
Entry
107676708         CDS       T04917                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04620  Toll-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107676708
   04012 ErbB signaling pathway
    107676708
   04370 VEGF signaling pathway
    107676708
   04371 Apelin signaling pathway
    107676708
   04068 FoxO signaling pathway
    107676708
   04150 mTOR signaling pathway
    107676708
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107676708
  09143 Cell growth and death
   04210 Apoptosis
    107676708
   04218 Cellular senescence
    107676708
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107676708
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107676708
   04625 C-type lectin receptor signaling pathway
    107676708
  09152 Endocrine system
   04910 Insulin signaling pathway
    107676708
   04920 Adipocytokine signaling pathway
    107676708
   04914 Progesterone-mediated oocyte maturation
    107676708
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107676708
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107676708
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107676708
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107676708
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107676708
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107676708
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11 Seadorna_VP7 Pkinase_fungal FTA2 APH
Other DBs
NCBI-GeneID: 107676708
NCBI-ProteinID: XP_016326839
LinkDB
Position
Unknown
AA seq 473 aa
MSDVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQC
QLMKTERPKANTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQAVADSLHKQEEERMDS
SPDPMDMEVYLSKPRLKVTMHDFEYLKLLGKGTFGKVILVKEKATGKYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
ERAQFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGITEGATMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMDEIR
FPRTLGPEAKSLLSGLLQKDPKQRLGGGPDDAKETMQHKFFAGIEWQDVYEKKLVPPFKP
QVTSETDTRYFDVEFTGQTITITPPGQDENMESFDSDRIPHFPQFSYSASGTA
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgagtgatgttgtcattgtgaaagagggatggctacataagagaggagaatacataaaa
acatggagaccaagatatttcttactcaagagtgatggaacatttattgggtacaaagag
cggccgcaagatgttgaccagctggaaactccacttaacaacttctcagtggcccaatgt
cagttgatgaagacagagcgaccgaaggcaaacacttttattattcggtgcctgcagtgg
actactgttattgaacgcacttttcatgttgagactccagaggaaagggaggagtggacg
aaggctatccaggctgtggcagatagtctacacaagcaggaggaagagagaatggactct
tcacctgaccccatggacatggaggtgtacctgtccaaacctcgactcaaagtgacaatg
catgactttgaatacctcaaactcttggggaaaggcacttttgggaaggtcatactggtg
aaggagaaagccacgggcaaatactatgccatgaaaattcttaaaaaggaggtgatagta
gcaaaagatgaggtagcacacacacttactgaaaaccgggtcctccagaactccaaacac
cctttcttaacaggtctgaagtattctttccagactcatgaccgattatgttttgttatg
gagtatgcaaatggtggagagcttttctttcatttatcgcgagatcgtgttttttcggaa
gagagagcacagttttatggggcagagatcgtctcagccctggattaccttcattctgag
aaaaatgtggtttatagagacctaaagttggagaatttgatgctggataaagacggccac
ataaagatcactgattttggcctgtgcaaggagggaattacagagggagccacaatgaag
acgttctgtggtacaccagagtatctggctcctgaggttcttgaggacaatgattatggc
cgggcggtggactggtgggggttgggtgtagtcatgtacgagatgatgtgcggccggctg
cccttctacaaccaggatcatgagaaactctttgaattgatcctcatggatgagatccgt
tttcctcgtacacttggacctgaggcaaaatctttgctgtcaggactacttcagaaagac
ccaaagcagcggttaggtggaggtccagatgatgcaaaagaaaccatgcagcataagttc
tttgcaggcattgagtggcaagatgtttatgagaagaagcttgttccaccctttaagccc
caggtaacctcagaaacagacactcgctattttgatgtggagtttacaggtcagaccatc
accatcacacccccaggccaagatgaaaacatggagtcctttgacagtgatagaataccc
cacttccctcagttctcatattctgccagtggcacagcataa

KEGG   Sinocyclocheilus anshuiensis: 107678753
Entry
107678753         CDS       T04917                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04620  Toll-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107678753
   04012 ErbB signaling pathway
    107678753
   04370 VEGF signaling pathway
    107678753
   04371 Apelin signaling pathway
    107678753
   04068 FoxO signaling pathway
    107678753
   04150 mTOR signaling pathway
    107678753
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107678753
  09143 Cell growth and death
   04210 Apoptosis
    107678753
   04218 Cellular senescence
    107678753
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107678753
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107678753
   04625 C-type lectin receptor signaling pathway
    107678753
  09152 Endocrine system
   04910 Insulin signaling pathway
    107678753
   04920 Adipocytokine signaling pathway
    107678753
   04914 Progesterone-mediated oocyte maturation
    107678753
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107678753
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107678753
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107678753
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107678753
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107678753
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107678753
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C Seadorna_VP7 FTA2 APH Pkinase_fungal
Other DBs
NCBI-GeneID: 107678753
NCBI-ProteinID: XP_016329618
LinkDB
Position
Unknown
AA seq 384 aa
MFVLLCREEWTKAIQTVSDSLQKQEEEMMDASPEHMDMEMFLTKPRLKVTMHDFEYLKLL
GKGTFGKVILVKEKATGKYYAMKILKKEVIVAKDEVAHTLAENRVLQNSKHPFLTGLKYS
FQTHDRLCFVMEYANGGELFFHLSRDRVFSEDRARFYGAEIVSALDYLHSERNVVYRDLK
LENLMLDKDGHIKITDFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLG
VVMYEMMCGRLPFYNQDHERLFELILMEDIRFPRTLAPDAKSLLSGLLKKDPQQRLGGGP
DDAKEIMQHKFFTGIVWQDVYEKKLVPPFKPQVSSETDTRYFDEEFTGQTITITPPGQED
SMESFDSERRPHFPQFSYSASGTA
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgtttgtgttgttgtgtagagaggaatggaccaaagccatccagaccgtgtccgacagt
ctgcagaaacaagaggaggagatgatggacgcgtctccagaacacatggacatggagatg
tttctgaccaaacctcgactcaaagtgactatgcatgacttcgaatacctcaaactgctg
ggaaaaggcacttttgggaaggtgattttggtgaaggagaaagcaacgggaaaatattac
gccatgaaaatcctcaagaaagaagtgattgtagccaaagatgaagtggctcacacactc
gcagagaaccgtgtgctgcagaactccaaacaccccttcctcacgggtctgaaatactct
ttccagacccacgaccgcttgtgtttcgtcatggagtacgcaaacggaggagagcttttc
ttccacttgtctcgggatcgggttttctcggaggatcgtgcacgtttctatggagctgag
atcgtgtctgcgctggattacctgcattcagagcgaaacgtggtctacagggacctgaag
ctggaaaacctgatgctggataaagacggtcacataaagatcacggactttggcttgtgt
aaggagggaatcacagacggagccacgatgaagaccttctgtgggactccagagtatctg
gctcctgaggtgctggaggataatgactacggtcgtgcggtggactggtggggtttgggt
gtggtgatgtatgagatgatgtgcggccgcctgccattctataaccaggatcacgagcgt
ctgtttgagctcatcctgatggaggacatccgcttccctcgaacactcgcgcccgatgcc
aagtccctgctgtccggcctgctcaagaaagacccccaacaacggttaggtggtggcccg
gatgatgcgaaagaaatcatgcagcacaaattcttcactggaattgtgtggcaagacgtt
tacgaaaagaagctggttcctccgttcaaaccacaggtgagctcagaaacagacaccaga
tatttcgatgaagagttcacaggacagaccatcaccatcacgccgccgggacaagaagac
agtatggagtcgttcgacagcgagaggaggccacacttcccacagttctcctactcggcc
agcggaacggcctaa

KEGG   Sinocyclocheilus anshuiensis: 107679018
Entry
107679018         CDS       T04917                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04620  Toll-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107679018
   04012 ErbB signaling pathway
    107679018
   04370 VEGF signaling pathway
    107679018
   04371 Apelin signaling pathway
    107679018
   04068 FoxO signaling pathway
    107679018
   04150 mTOR signaling pathway
    107679018
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107679018
  09143 Cell growth and death
   04210 Apoptosis
    107679018
   04218 Cellular senescence
    107679018
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107679018
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107679018
   04625 C-type lectin receptor signaling pathway
    107679018
  09152 Endocrine system
   04910 Insulin signaling pathway
    107679018
   04920 Adipocytokine signaling pathway
    107679018
   04914 Progesterone-mediated oocyte maturation
    107679018
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107679018
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107679018
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107679018
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107679018
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107679018
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107679018
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 107679018
NCBI-ProteinID: XP_016329915
LinkDB
Position
Unknown
AA seq 479 aa
MNEVSIVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPETSDHNQPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSNAEREEWIRAIQAVANGLKSREEEEPMD
INFGSPGDNSLEGMEAAIAKSRTKVVISSVFYLKLLGKGTFGKVILVREKATGMYYAMKI
LRKEVIIAKDEVAHTITESRVLQNTRHPFLTTLKYAFQTRDRLCFVMEYANGGELFFHLS
RERVFTEDRARFYGAEIVSALEYLHSKDVVYRDLKLENLMLDIDGHIKITDFGLCKEGIT
NEATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELI
LMEEIRFPRNLSPEAKALLAGLLKKDPKQRLGGGPEDAKEVMTHKFFSSMNWQDVLQKKL
IPPFKPQVTSEIDTRYFDDEFTAQTITVTPPDQYDSLDAEDPDTRTHFSQFSYSASVRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaacgaggtcagcatcgtcagagagggctggctccacaagagaggtgaatacattaag
acttggaggccccggtatttcatcctaaagagtgatggctctttcattggctacaaggag
aagccagagacgtcagaccacaatcagccccctctcaataacttctctgttgcagagtgt
cagctgatgaagactgaacgacctcggccgaacacgtttgtcatccgctgcttgcagtgg
accactgttattgagcggaccttccacgtggatagcaatgctgaaagagaggagtggata
cgtgcaatccaggctgtggccaatgggctcaagtcccgggaagaggaggagccaatggac
atcaactttggctcccctggagacaacagcctggagggaatggaggctgcaattgcaaag
tcacgcaccaaagtggtaatttcatctgttttctacttaaagctgctgggtaaaggcact
tttggaaaggtgattctagtgagggaaaaggctactggcatgtactacgccatgaagatc
ctacgcaaagaggtcatcattgctaaggacgaggttgcacatacaatcacagaaagcaga
gtgttacagaacacacggcaccccttccttacgacactaaaatacgccttccagacacga
gatcgattgtgttttgtcatggagtacgcaaatggaggcgagctgttcttccacttgtct
cgagagcgtgtgtttacggaggatagagctcgcttctatggggctgaaattgtttcagca
ttggaatatctgcactctaaagatgttgtctacagggacctaaagctggagaatctaatg
ctggatatagatggtcacattaaaatcacagactttggcctgtgtaaagagggcattact
aatgaggccaccatgaagacattttgtgggaccccagagtaccttgctcctgaggtatta
gaagacaacgattacggccgtgcagtggattggtggggtctgggagtggtcatgtatgaa
atgatgtgtggtcggctgccgttctataaccaggaccatgaacgtctgtttgagctcatt
ttaatggaggagattcgcttccccagaaacctctcgcccgaggcaaaggccttgctggcc
ggcctgctcaagaaagaccccaaacagaggcttggaggaggtcctgaggatgccaaagaa
gtgatgacacacaagttcttcagttccatgaactggcaagatgtccttcaaaagaagctc
atcccacccttcaagccgcaagtgacctcagagatagacacacgctactttgacgacgag
ttcactgcacagaccattactgtcacgccacctgaccaatatgacagtcttgatgcggag
gacccagatacacgcacacacttctcacagttctcctactcagccagtgtgcgggagtga

KEGG   Sinocyclocheilus anshuiensis: 107692744
Entry
107692744         CDS       T04917                                 

Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04620  Toll-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107692744
   04012 ErbB signaling pathway
    107692744
   04370 VEGF signaling pathway
    107692744
   04371 Apelin signaling pathway
    107692744
   04068 FoxO signaling pathway
    107692744
   04150 mTOR signaling pathway
    107692744
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107692744
  09143 Cell growth and death
   04210 Apoptosis
    107692744
   04218 Cellular senescence
    107692744
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107692744
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107692744
   04625 C-type lectin receptor signaling pathway
    107692744
  09152 Endocrine system
   04910 Insulin signaling pathway
    107692744
   04920 Adipocytokine signaling pathway
    107692744
   04914 Progesterone-mediated oocyte maturation
    107692744
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107692744
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107692744
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107692744
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107692744
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107692744
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107692744
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 107692744
NCBI-ProteinID: XP_016347401
UniProt: A0A671M1K5
LinkDB
Position
Unknown
AA seq 479 aa
MNEVSIVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPDTSDHNQPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSNAEREEWIRAIQAVANGLKSREEEEPMD
INFGSPGDNSLEGMEAAIAKSRTKVTMSDFDYLKLLGKGTFGKVILVREKATGMYYAMKI
LRKEVIIAKDEVAHTITESRVLQNTRHPFLTTLKYAFQTRDRLCFVMEYANGGELFFHLS
RERVFTEDRARFYGAEIVSALEYLHSKDVVYRDLKLENLMLDKDGHIKITDFGLCKEGIT
NEATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELI
LMEEIRFPRNLLPEAKALLAGLLKKDPKQRLGGGPDDAKEVMTHKFFSSMNWQDVLQKKL
MPPFKPQVTSETDTRYFDDEFTAQTITVTPPDQYDSLDAEDPDTRTHFSQFSYSASVRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaacgaggtcagcatcgtcagagagggctggctccacaagagaggtgaatacattaag
acttggaggccccgatatttcatcctaaagagtgatggctctttcatcggctacaaggag
aagccagatacgtcagaccacaatcagccgcctctcaataacttttctgttgcagagtgt
cagctgatgaagactgaacgacctcggccaaacacgtttgtcatccgctgcttgcagtgg
accactgttattgagcgcaccttccatgtggacagcaatgctgaaagagaggagtggata
cgtgcaatccaggctgtggccaatgggctcaagtcccgggaagaggaggagccaatggac
atcaactttggctcccctggcgacaacagcttggaggggatggaggctgccatcgcaaag
tcccgcaccaaagtgacaatgagtgactttgactacttaaagctgctgggtaaaggcact
tttggaaaggtgattctagtaagggaaaaggctactggcatgtactatgccatgaagatc
ctacgcaaagaggtcatcattgctaaggacgaggttgcacacacaatcacagaaagcaga
gtgttgcagaacacacggcatccgttccttacaacactaaaatacgccttccagacacga
gatcgattgtgtttcgtcatggagtacgcaaatggaggcgagctgttcttccacttgtct
cgagagcgtgtgtttacggaggatagagctcgcttctatggggctgaaattgtttcagca
ttggaatatctgcactctaaagacgtcgtctacagggacctaaagctggagaatctgatg
ctggacaaagatggtcatattaaaatcacagactttggcctgtgtaaagagggcattact
aatgaggccaccatgaagacattctgtgggaccccagagtaccttgctcctgaggtatta
gaagacaatgattacggccgtgcagtggattggtggggtctgggagtggtcatgtatgaa
atgatgtgtggtcggctgccgttctataaccaggaccacgaacgtctgtttgagctcatt
ttaatggaggagattcgcttccctagaaacctcttgcccgaggcaaaggccttgctggcc
ggactgctcaagaaagaccccaaacagaggcttggaggaggtcctgatgatgccaaagaa
gtgatgacacacaagttcttcagttccatgaactggcaagatgtccttcaaaagaagctc
atgccacccttcaagccgcaagtgacctcagagacagacacacgctactttgacgacgag
ttcactgcacagaccattactgtcacgccacctgaccaatatgacagtcttgatgccgag
gacccagatacacgcacacacttctcgcaattctcctactcagccagtgtgcgggagtga

KEGG   Sinocyclocheilus anshuiensis: 107698756
Entry
107698756         CDS       T04917                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04620  Toll-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107698756
   04012 ErbB signaling pathway
    107698756
   04370 VEGF signaling pathway
    107698756
   04371 Apelin signaling pathway
    107698756
   04068 FoxO signaling pathway
    107698756
   04150 mTOR signaling pathway
    107698756
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107698756
  09143 Cell growth and death
   04210 Apoptosis
    107698756
   04218 Cellular senescence
    107698756
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107698756
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107698756
   04625 C-type lectin receptor signaling pathway
    107698756
  09152 Endocrine system
   04910 Insulin signaling pathway
    107698756
   04920 Adipocytokine signaling pathway
    107698756
   04914 Progesterone-mediated oocyte maturation
    107698756
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107698756
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107698756
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107698756
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107698756
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107698756
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107698756
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2
Other DBs
NCBI-GeneID: 107698756
NCBI-ProteinID: XP_016355342
LinkDB
Position
Unknown
AA seq 472 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTLEERDEWAEAIQMVADKLQRQEEERIQCS
PTSQIDNMGEEEMDTSISHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGVCSTALTDE
CFQMCVCSQVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPR
TLSTDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFAGIDWQDVYDKKLMPPFKPQVS
SETDTRYFDEEFTAQTITITPPEKFDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgagcgatgtcaccatcgttaaggaaggctgggtccagaagagaggtgaatatattaag
aattggagacctcgctacttcctgctaaaaaccgatgggtcctttatcggatacaaggag
aagccacaggatgcagatcttccctaccctctcaataacttctctgttgcaaaatgccag
ctgatgaaaactgaacgaccaaagccgaacacttttattattagatgtctacagtggact
acagtcatagagaggaccttccacgtggacacactagaagagagggatgagtgggcagag
gcgatccagatggtggcagataaactccaaagacaggaagaggaacgtatccagtgtagt
cccacctcacagatagacaacatgggagaggaggagatggacacatctatcagccatcac
aaacgcaagacaatgaatgactttgactacttaaaattattgggaaaaggcacttttgga
aaagtcattctcgtaagggagaaggccagcgggaaatattatgcaatgaaaattttaaag
aaagaggttattatagcaaaggacgaagtggcccacacgcttacagaaagcagagtacta
aaaaacacgaggcatccttttttaacttctttgaagtactcgttccaaacaaaagaccgc
ctatgcttcgtgatggagtatgtcaatggaggagagctgtttttccatttgtcgagagaa
cgggtgttctccgaggaccgcacgcgcttctacggcgccgagatcgtttccgccctcgac
tacctgcactctgccaagattgtgtaccgggatctgaagttggagaacttaatgcttgat
aaagatggacacatcaaaattacagactttggcgtctgttccactgccctcactgatgaa
tgttttcaaatgtgtgtttgttctcaggtgctggaggacaatgattacggccgtgcggtg
gactggtggggtctcggtgtggtcatgtatgagatgatgtgtggccgactgcctttctac
aatcaggaccatgagaagctctttgagctcatcctaatggaggacatcaagttcccccgg
accctctctactgatgccaagtccctactgtcaggcctgctcatcaaagatcccaataag
agacttggtggaggtccggatgatgctaaggaaattatgcgacatagtttctttgctgga
attgactggcaggatgtctatgataaaaagctgatgcctcccttcaagcctcaggtgtca
tcagagacagataccagatatttcgatgaagagttcacagctcagacgattacaataacc
cctcctgaaaaatttgatgaagatgggatggactgcatggacaacgagcgacggccacac
ttcccccagttctcctactccgccagcgggagagagtga

KEGG   Sinocyclocheilus anshuiensis: 107700803
Entry
107700803         CDS       T04917                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04620  Toll-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107700803
   04012 ErbB signaling pathway
    107700803
   04370 VEGF signaling pathway
    107700803
   04371 Apelin signaling pathway
    107700803
   04068 FoxO signaling pathway
    107700803
   04150 mTOR signaling pathway
    107700803
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107700803
  09143 Cell growth and death
   04210 Apoptosis
    107700803
   04218 Cellular senescence
    107700803
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107700803
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107700803
   04625 C-type lectin receptor signaling pathway
    107700803
  09152 Endocrine system
   04910 Insulin signaling pathway
    107700803
   04920 Adipocytokine signaling pathway
    107700803
   04914 Progesterone-mediated oocyte maturation
    107700803
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107700803
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107700803
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107700803
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107700803
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107700803
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107700803
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 107700803
NCBI-ProteinID: XP_016358104
LinkDB
Position
Unknown
AA seq 350 aa
MNDQNVVKEGWVQKRGEYIKNWRPRYFLLKMDGSFIGYKEKPQDADLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERYHTPKSNYLFFHLSRERVFSEDRTR
FYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDTATMKTFCGT
PEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIKFPRTL
SADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFTTLHWQHVYDKKLVPPFMPQVSSE
TDTRYFDEEFTAQTITITPPEKYDEDGMDSADSERRPHFPQFSYSASGRE
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgaacgaccagaacgtagtgaaagagggatgggtgcagaagagaggtgaatacattaag
aactggagaccgcggtacttcctgttaaagatggatgggtcgtttattggatataaagag
aagccgcaagatgcagatctggcttatccactcaacaacttctctgtggccaagtgtcag
ctgatgaagacggagagaccgaagcccaacaccttcatcatcaggtgtctgcagtggacc
actgtgatcgagcgcacgtttcacgtggacacgcctgacgagaggtaccacacgcccaaa
tcaaattatctgttttttcatttgtcgagagagcgtgtattttcggaggatagaacccgt
ttctacggcgctgagatcgtttctgcgttggattacttgcactctgcgaagattgtttac
cgtgacctaaagctggaaaacctgatgttggataaggacggtcacataaagatcactgat
ttcggcctgtgtaaggagggcatcacagacacggccaccatgaaaacgttctgcgggacc
ccggagtatctggcccctgaggtattggaggacaatgattatgggagagcggtggactgg
tggggtctgggagtcgttatgtatgagatgatgtgtggacgccttcccttttataatcag
gaccatgagaagctgtttgaactgattctgatggaggagatcaagtttcccagaaccctc
tctgcagacgccaagtctttactgtctggattactcatcaaagaccccaataagaggctc
ggaggaggcccggatgatgcaaaggaaatcatgaggcacagtttcttcactacgctgcac
tggcagcacgtctatgacaaaaagctggtaccgccgttcatgccgcaggtctcatctgag
acggacaccaggtatttcgacgaggagttcacggcgcagaccatcaccatcacccctcca
gagaagtacgacgaggatgggatggactcggccgatagcgaacggagaccacatttccca
caattctcgtattcggccagcgggcgggagtga

KEGG   Sinocyclocheilus anshuiensis: 107703621
Entry
107703621         CDS       T04917                                 

Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04620  Toll-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107703621
   04012 ErbB signaling pathway
    107703621
   04370 VEGF signaling pathway
    107703621
   04371 Apelin signaling pathway
    107703621
   04068 FoxO signaling pathway
    107703621
   04150 mTOR signaling pathway
    107703621
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107703621
  09143 Cell growth and death
   04210 Apoptosis
    107703621
   04218 Cellular senescence
    107703621
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107703621
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107703621
   04625 C-type lectin receptor signaling pathway
    107703621
  09152 Endocrine system
   04910 Insulin signaling pathway
    107703621
   04920 Adipocytokine signaling pathway
    107703621
   04914 Progesterone-mediated oocyte maturation
    107703621
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107703621
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107703621
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107703621
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107703621
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107703621
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107703621
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C Seadorna_VP7 PH_11 FTA2 APH
Other DBs
NCBI-GeneID: 107703621
NCBI-ProteinID: XP_016361805
LinkDB
Position
Unknown
AA seq 474 aa
MTTDVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQ
CQLMKTERPKPNTFIIRCLQWTTVIERTFHVERPEEREEWTKAIQTVSDSLQKQEQEMMD
VSPEHMDMEMFLTKPRLKVTMHDFEYLKLLGKGTFGKVILVKEKATGKYYAMKILKKEVI
VAKDEVAHTLAENRVLQNSKHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFS
EDRARFYGAEIVSALDYLHSERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGITDGATM
KTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEDI
RFPRTLAPDAKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFTGIVWQDVYEKKLVPPFK
PQSTSETDTRYFDEEFTGQTITITPPGQDDSMESFDSERRPHFPQFSYSASGTA
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgacgacggacgtggtgatcgtgaaggagggatggctccacaagcgaggagagtacata
aagacgtggaggccacggtatttcttgctgaagagtgacggtacgtttatcggctataag
gagcgtccgcaggacgtggatcagctggagacgccgttaaacaacttctccgtggcacag
tgtcagctgatgaagacggagcggcccaaacccaacacattcatcatacgctgcctgcag
tggaccactgtcattgagcgcaccttccatgtggagaggcctgaggagcgagaggaatgg
accaaagccatccagaccgtgtccgacagtctgcagaaacaagagcaggagatgatggac
gtgtctccagaacacatggacatggagatgtttctgaccaaacctcggctcaaagtgact
atgcacgacttcgaatacctcaaactgctgggaaaaggcacttttgggaaggtgattctg
gtgaaggaaaaagcaacgggaaaatattacgccatgaaaatcctcaagaaagaagtgatt
gtagccaaagatgaagtggctcacacactcgcagagaaccgtgtgctgcagaactccaaa
caccccttcctcacggctctgaagtactctttccaaacccacgaccgcttgtgtttcgtc
atggagtacgcaaacggaggagagcttttcttccacttgtctcgggatcgggttttctca
gaggatcgcgcgcgtttctacggagcagagatcgtgtctgcgctcgactacctgcattca
gagagaaacgtggtctacagggacctgaagctggaaaacctgatgctggataaagacggt
cacataaagatcactgactttggcttgtgtaaggagggaatcacagacggagccaccatg
aagaccttctgtgggactccagagtatctggctcctgaggtgctggaggataatgactac
ggtcgtgcggtggactggtggggtttgggagtggtgatgtatgagatgatgtgtggccgt
ctgccgttctataaccaggatcacgagcgtctgtttgagctcatcctgatggaggacatc
cgcttccctcgaacactcgcacccgacgccaaatccctgctgtccggcctgctcaagaaa
gaccccaaacaacggttaggcggcggcccggatgatgccaaagaaatcatgcagcacaaa
ttcttcactggaattgtgtggcaagacgtttacgagaagaagctggttcctccgttcaaa
ccgcagtcgacctcagagacagacaccagatatttcgatgaggagttcacaggacagacc
atcaccatcacaccgccgggacaagatgacagtatggagtcgttcgacagcgagaggagg
ccacacttcccacagttctcctactcggccagcggaacggcgtaa

KEGG   Sinocyclocheilus anshuiensis: 107703832
Entry
107703832         CDS       T04917                                 

Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase-like
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04620  Toll-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04910  Insulin signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107703832
   04012 ErbB signaling pathway
    107703832
   04370 VEGF signaling pathway
    107703832
   04371 Apelin signaling pathway
    107703832
   04068 FoxO signaling pathway
    107703832
   04150 mTOR signaling pathway
    107703832
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107703832
  09143 Cell growth and death
   04210 Apoptosis
    107703832
   04218 Cellular senescence
    107703832
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107703832
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107703832
   04625 C-type lectin receptor signaling pathway
    107703832
  09152 Endocrine system
   04910 Insulin signaling pathway
    107703832
   04920 Adipocytokine signaling pathway
    107703832
   04914 Progesterone-mediated oocyte maturation
    107703832
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107703832
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107703832
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107703832
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107703832
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107703832
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107703832
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like APH
Other DBs
NCBI-GeneID: 107703832
NCBI-ProteinID: XP_016362072
LinkDB
Position
Unknown
AA seq 479 aa
MNDQNVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERDEWVEAIQMVADKLAKQEEEGILCS
PISQIENVNEEEMDTSTSHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGIYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDT
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFTTVDWQDVYDKKLVP
PFMPQVSSETDTRYFDEEFTAQTITITPPEKYDEDGMDSADSERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaacgaccagaacgtagtgaaagagggatgggtgcagaaaagaggtgaatacattaag
aactggagaccgcggtacttcctgttaaagacggatgggtcgtttattggatataaggag
aagccacaagatgccgatctggcgtatccgctcaacaacttctctgtggccaagtgccag
ttgatgaagacggagagaccgaagcccaacaccttcatcatccggtgtctgcagtggacc
actgtgatcgagcgcacgtttcacgtggacacgcctgacgagagggatgagtgggtcgag
gccattcagatggtggcagacaagctggccaaacaggaagaggaaggaatcctgtgtagc
cccatctctcagattgaaaacgtcaacgaggaagagatggacacgtcaaccagtcatcac
aaacgaaagacaatgaatgactttgactatctgaagctgctgggtaaaggcacatttggg
aaggtgattctggtgcgagagaaagccagcggaatatattatgcaatgaagatcctgaaa
aaggaggttattattgccaaggatgaagttgctcacacactcaccgagagcagagttctg
aagaacactaggcatccctttctaacttcactgaagtactcatttcagacgaaggatcgt
ttatgttttgttatggagtacgtgaatggaggagagctgttttttcatttgtcgagagag
cgcgtattttcggaggatagaacccgtttctacggcgctgagatcgtttctgcgttggat
tacttgcactctgcgaagattgtttaccgtgacctgaagctggaaaacctgatgttggat
aaggacggtcacataaagatcactgatttcggcctgtgtaaggagggcatcacagacacg
gccaccatgaaaacgttctgcgggaccccggagtatctggcccctgaggtattggaggac
aatgattatgggagagcggtggactggtggggtctgggagtcgttatgtatgagatgatg
tgtggacgcctgcccttttataatcaggaccatgagaagctgtttgaactgattctgatg
gaggagatcaagtttcccagaaccctctctgcagacgccaagtctttactgtctggatta
ctcatcaaagaccccaataagaggctcggaggaggtccggatgatgctaaggaaatcatg
agacacagtttcttcactacagtggactggcaggacgtctatgacaaaaagctggtaccg
ccgttcatgccgcaggtctcgtctgaaaccgacaccaggtatttcgacgaggagttcacg
gcgcagaccatcaccatcacccctccggagaagtacgacgaggacgggatggactcggct
gatagcgaacggagaccacatttcccacaattctcgtattcggccagcgggcgggagtga

DBGET integrated database retrieval system