KEGG   Sinocyclocheilus anshuiensis: 107666459Help
Entry
107666459         CDS       T04917                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00010  Glycolysis / Gluconeogenesis
sanh00051  Fructose and mannose metabolism
sanh00052  Galactose metabolism
sanh00500  Starch and sucrose metabolism
sanh00520  Amino sugar and nucleotide sugar metabolism
sanh00524  Neomycin, kanamycin and gentamicin biosynthesis
sanh01100  Metabolic pathways
sanh01200  Carbon metabolism
sanh04910  Insulin signaling pathway
Module
sanh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sanh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107666459
   00051 Fructose and mannose metabolism
    107666459
   00052 Galactose metabolism
    107666459
   00500 Starch and sucrose metabolism
    107666459
   00520 Amino sugar and nucleotide sugar metabolism
    107666459
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107666459
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107666459
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107666459
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107666459
Membrane trafficking [BR:sanh04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107666459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 107666459
NCBI-ProteinID: XP_016313267
LinkDB All DBs
Position
Unknown
AA seq 913 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRFSDETLRDIMARFRREMENGLGRDINPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYETPEDIIH
GSGSRLFDHVAECLGDFMEKQKIKDKKLPMGFTFSFPCAHSKLDEAVLLTWTKRFKASGV
EGMDVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDMVEGDEGRMCINTEWGAFGDDGTLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFDTKHVSAIEKSKEGLTKANEILTRLG
VEPSEDDCIAVQHVCAIVSFRSANLIAATLGAILTRLKDNKNSPRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPESDVRFLLSESGSGKGAAMVTAWASRLADQTRQIAETLAQFRLT
KEQLLEVKKRMRTEIQNGLSKNTQSTATVKMLPTYVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEVMQGTGEELFDHIVYCISDFLDYMGMKNARLPLGF
TFSFPCRQTSLDAGMLVTWTKGFKATDCEGEDVVGLLREAIKRREEFDLDVVAIVNDTVG
TMMTCAYEEPTCEVGLIAGTGSNACYMEEIRNIETVDGVDGRMCVNMEWGAFGDNGCLDD
IRTQYDNAVDDLSLNAGKQKYEKMCSGMYLGEIVRNILTDLTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGAVSRRAAQICGAGMAA
VVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKELAPKCNVNFLLSEDGSGKG
AALITAVGCRLRQ
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgatagcggcacagcttctggcctactacttcactgaactgaaggatgaccaggtcaaa
aagattgacaaatacttgtacgccatgcggttctctgacgagacgctgcgcgacatcatg
gcccgcttccgaagggaaatggagaacggattgggacgagacattaatccgacagctacc
gtcaagatgttgcccaccttcgtaaggtccattcctgatggatcagagaagggagatttc
attgcccttgatctgggcggctctaatttccgtattctgcgggtgaaagtgtctcatgag
aagaaacagacagtgcagatggaaagtcagatatatgagactccagaggacatcatccac
ggcagcggatcacggttgtttgaccatgttgcagaatgtcttggagacttcatggagaaa
caaaaaattaaagacaagaagcttcccatgggtttcacgttctcattcccttgtgcacac
tccaaactggatgaggccgttttgctaacatggacaaaacgttttaaggccagtggggtt
gagggaatggatgtagtaaagcttctaaataaagccatcaaaaaacgtggggactatgat
gcagatatcatggctgttgtcaatgacactgtgggaactatgatgacctgtggctttgat
gaccagcgctgtgaagtcggcattattataggtaccggcactaatgcatgttacatggag
gagctcagacacattgacatggtggagggagatgaaggcaggatgtgtattaatactgaa
tggggggcttttggagacgacggtacactggaggatatccgaactgagtttgacagggag
attgatcgtgggtccctcaaccccggcaagcaattgtttgagaagatggtcagtgggatg
tatatgggtgagctggtgaggctgatcctggtcaagatggctaaggaaggcctgctgttt
gagggccgcattaccccagaactgcttacaaaaggaaaatttgacaccaagcatgtttct
gcaattgaaaagagtaaagaaggacttaccaaagccaatgagattttgacacgcttgggt
gtagagccatctgaagacgactgcattgctgtgcagcatgtttgcgctattgtctctttt
cgctctgcaaatctaattgctgccactctaggtgcaatcctcacacgtctcaaggacaat
aagaacagtccacgcctccgcaccacagtgggcatcgatggttccctgtacaagatgcac
ccacagtatgcccgccggttgcacaaaactgtgcgtcgtctggtgccagagtctgatgtt
cgcttcttgctctctgaaagtggaagtggcaaaggggctgcaatggtaacagcctgggct
tctcggttggccgatcagacacgtcagattgccgagacgctggcacagttccgtttgacc
aaagaacaactgctggaggtgaaaaagagaatgagaactgagatccagaatggattgagc
aagaacacccaaagcacagccaccgtcaagatgctgcccacttatgtgcggagcacccca
gatggaacagaaaatggtgactttttggctctggatcttggaggtacaaacttcagggtg
cttttggtaaagattcgcagtggcaagaaacgaactgtggagatgcataataaaatctac
gccattcccattgaagtaatgcaaggaaccggagaagagctatttgatcacattgtgtac
tgcatatctgacttcctggactatatggggatgaagaatgcccgcctgcctttgggcttt
accttttccttcccctgcagacaaactagtctggatgcgggaatgctggtaacttggaca
aagggctttaaagccacagactgtgaaggagaagatgttgtcggcctcctgagagaggct
atcaagaggagagaggagtttgatttggatgttgtagccatagtgaatgacacagtgggt
acaatgatgacctgcgcatatgaggaacccacatgtgaggttgggctaattgcaggaaca
ggtagtaatgcctgctacatggaggaaatacgaaacattgagacagtcgatggcgtggac
ggcaggatgtgtgtgaacatggagtggggagcatttggagataatggctgcctggatgac
atcaggactcagtatgataatgctgtggatgatctctccctcaatgccggcaaacaaaag
tatgagaagatgtgcagtgggatgtacctgggtgagattgtacggaacatcctgactgac
ttgacaaagcgtggcttcctcttcagaggacagatctctgagaccctgaagaccaggggt
atctttgaaaccaagttcctttcccaaatcgagagtgaccgtttggcgctactgcaggtc
aggtccattctgcagcacctgggcctggacagcacgtgtgacgacagtattatcgtcaag
gaagtgtgtggagctgtttcccgccgggctgcccagatctgtggagcaggaatggccgct
gttgtagacaaaatccgagaaaaccgtggtctggaccatctggatatcaccgttggggtg
gatggcactctgtataagctccatccacatttctcacggataatgcatcagactgtgaag
gagctagcccccaaatgcaacgtcaacttcctgctctcagaagacggaagcgggaaaggt
gccgccttgatcaccgccgttgggtgccgcctccgccagtaa

DBGET integrated database retrieval system