KEGG   Sinocyclocheilus anshuiensis: 107666631Help
Entry
107666631         CDS       T04917                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk3-like
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107666631
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107666631
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107666631
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   107666631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PX Pkinase_C FTA2 Kinase-like Kdo APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 107666631
NCBI-ProteinID: XP_016313541
LinkDB All DBs
Position
Unknown
AA seq 486 aa AA seqDB search
MEEQPSCPNVSIPCSNEQRDKKKRYTVYKVIVSVGRHEWFVFRRYAEFDRLYNTLKKQFP
VLNLKIPAKRIFGDNFDPEFIKHRRAGLHEFIQKIVSHPQLCNHPDVKDFLQMDKSKNFS
DASEDEDDKSTSTSRNINLGPSANPHAKPTDFDFLKVIGKGSFGKVLLAKRKWDGKCYAI
KVLQKKVILNRREQKHIMAERNVLLKNVKHPFLVGLHYSFQTTDKLYFVLDFVNGGELFF
HLQKERTFPEPRAKFYIAEMASALGYLHSLTIVYRDLKPENILLDSQGHIVLTDFGLCKE
GISQADTTTTFCGTPEYLAPEVLRKQPYDNTVDWWCLGSVLYEMLYGLPPFYSRDTHEMY
DNILHKELVMRPGASTAAWSILQALLEKDHTRRLGYRDDFNEVTEHEFFSTINWDDLEKK
KLPPPFNPSVESQYDISNFDPEFTEETVPNSVCFSSGQSIVNASVMEADDAFLGFSYAPP
SEDSFL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcaaccaagctgccccaatgtcagcattccctgctccaatgagcagagagac
aagaagaaacgctatactgtttacaaagtaattgtcagtgttggaaggcatgagtggttt
gtgttccggaggtatgcagaattcgacagactgtacaacaccttaaaaaaacagtttcct
gttctgaatttgaagattcctgctaagagaatatttggagacaactttgacccagagttc
ataaaacacagaagagcggggttacatgagtttattcagaagattgtgtcccatccacag
ctctgcaaccatccggatgtcaaagactttctgcagatggacaaatctaaaaacttctct
gatgcctcagaggatgaagatgataagagtacctctacctcgagaaatataaacctaggg
ccatctgcaaatccacatgcaaagcccactgactttgactttcttaaagtcataggaaag
ggaagctttgggaaggttcttcttgcaaagaggaaatgggatgggaagtgttacgccatc
aaagtcttgcaaaaaaaggtcattttaaacaggagagagcaaaagcacattatggctgaa
cgtaatgtgttgctaaagaatgttaaacaccccttcctggttggactgcactattccttt
cagacaacagacaagttatactttgtcctggattttgtcaatggtggagaacttttcttt
cacctccaaaaagagcggacctttcctgaacccagagcgaagttttacattgctgagatg
gcaagtgctttgggttacttacactctcttaccattgtttacagggatttgaaaccagaa
aatatcctgctggactctcaaggacatatagtcttgactgactttggactgtgtaaggag
ggcatctctcaagcagacacaacgaccacattttgtgggacacctgagtatctagctcca
gaggtactcaggaaacaaccctatgataacactgtggactggtggtgtctgggttctgtg
ctgtatgaaatgctttatgggctgcctccattctacagcagggacacacatgagatgtat
gacaacattcttcacaaggaacttgtcatgcgccccggggcatccacagctgcctggtcc
atccttcaggccctgctggagaaagaccacaccaggaggcttggctacagagatgacttt
aatgaagtcacagaacatgaatttttctcaacaattaactgggatgaccttgaaaagaaa
aagcttcctcctccattcaaccctagtgtggaatcccagtatgacatctcaaactttgat
cctgagttcacagaggaaaccgtgccaaactctgtgtgcttctcttcagggcagtcaatt
gtcaatgctagtgttatggaagctgatgatgccttcctgggattttcttacgctccgccg
tcagaagattctttcctgtaa

DBGET integrated database retrieval system