KEGG   Sinocyclocheilus anshuiensis: 107668652
Entry
107668652         CDS       T04917                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107668652
   04068 FoxO signaling pathway
    107668652
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107668652
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107668652
NCBI-ProteinID: XP_016316082
UniProt: A0A671NBF0
LinkDB
Position
Unknown
AA seq 179 aa
MSNVRLSNGSPTLERMEARLSNQPKPSACRNLFGPVDHEELKKDFQRQLKAMEDASADAW
NFDFSTHTPHTDGRYQWDALDIRSVPGFYSRSVRAKGSDLHMCSSGNNSDNNVDVNGNHD
CRVTEQSAETPEKDREQRKRTSCLDSSCQSKRSHICADEVTRTPRKPRKHPSPTRTQTQ
NT seq 540 nt   +upstreamnt  +downstreamnt
atgtccaacgtgcgcttgtctaacggcagcccgacgctggaacggatggaggcgcgactg
tcaaaccagcccaagccgtcggcgtgtcggaacctgttcggtccggtggatcatgaagag
ttaaagaaggatttccagcggcagctgaaggcgatggaggacgcgtcggcggacgcgtgg
aacttcgacttctccacgcacacgccgcacaccgacggcagataccagtgggacgcgctg
gatattcgctcggtgcccggtttctacagcagatcggtgcgggcgaagggctccgatctt
cacatgtgctcctctgggaataatagcgacaataatgtggatgttaacggcaatcacgac
tgtcgcgtaacggagcagagcgcggagacgcccgaaaaagaccgagagcagaggaaaaga
acctcctgtctcgactcctcgtgtcaaagcaaacgctcacacatctgtgcggatgaagtg
acacggacgccgagaaaacccagaaaacaccccagcccgacacgtacacaaacccagtga

DBGET integrated database retrieval system