KEGG   Sinocyclocheilus anshuiensis: 107668740
Entry
107668740         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04114  Oocyte meiosis
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04350  TGF-beta signaling pathway
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04520  Adherens junction
sanh04540  Gap junction
sanh04620  Toll-like receptor signaling pathway
sanh04621  NOD-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107668740
   04012 ErbB signaling pathway
    107668740
   04350 TGF-beta signaling pathway
    107668740
   04370 VEGF signaling pathway
    107668740
   04371 Apelin signaling pathway
    107668740
   04068 FoxO signaling pathway
    107668740
   04150 mTOR signaling pathway
    107668740
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107668740
  09143 Cell growth and death
   04114 Oocyte meiosis
    107668740
   04210 Apoptosis
    107668740
   04218 Cellular senescence
    107668740
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107668740
   04520 Adherens junction
    107668740
   04540 Gap junction
    107668740
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107668740
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107668740
   04621 NOD-like receptor signaling pathway
    107668740
   04625 C-type lectin receptor signaling pathway
    107668740
  09152 Endocrine system
   04910 Insulin signaling pathway
    107668740
   04912 GnRH signaling pathway
    107668740
   04914 Progesterone-mediated oocyte maturation
    107668740
   04916 Melanogenesis
    107668740
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107668740
   04270 Vascular smooth muscle contraction
    107668740
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107668740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107668740
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sanh03036]
    107668740
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107668740
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107668740
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107668740
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107668740
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107668740
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo
Other DBs
NCBI-GeneID: 107668740
NCBI-ProteinID: XP_016316202
UniProt: A0A671PMH7
LinkDB
Position
Unknown
AA seq 369 aa
MATAAVSAPAGGGPNPGSGAEMVRGQAFDVGPRYTNLSYIGEGAYGMVCSAYDRDNKVRV
AIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDINRTPTIDQMKDVYIVQDLMETD
LYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLA
RVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGK
HYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFPNADPKALDLLD
KMLTFNPHKRIEVEEALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKELIFEET
ARFQPGYRP
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggcgacagctgcggtatctgcccctgctggcggcggcccgaaccccggatccggtgcc
gagatggtccgcggtcaggctttcgacgtcgggccacgttacactaacctctcgtacatc
ggagaaggcgcatacggcatggtttgctcggcgtatgatcgtgataataaagtgcgtgtg
gcgataaagaaaatcagtccatttgagcaccagacgtactgtcagcgcacactccgtgag
attaaaatcctgctccgcttcaagcatgagaacatcatcggcatcaacgacatcaaccgc
accccaaccatcgaccagatgaaagacgtctacattgtacaggatctgatggagacagac
ttgtacaagctgttgaagacgcagcacttgagcaatgaccacatctgttacttcctgtac
cagatcttgcgtggcctgaagtacatccactcagcaaacgttctccacagagacctgaag
ccatctaacctgttgctcaacactacttgcgacctcaagatctgtgattttgggctcgcc
cgggtggctgatccagaccatgaccacactggcttcctgacggagtatgtagccacgcgt
tggtaccgcgcaccagagattatgctcaattccaagggttacactaagtccattgatata
tggtcggtcggttgcattctggctgagatgctttcgaatagacccatcttccctgggaaa
cactatctggaccagcttaaccacatcttaggtattttgggctccccctctcaggaggat
ctcaactgcattatcaacataaaggcaagaaattacctgctgtcacttcctctccgctgc
aaagtgccctggaaccgcctgtttcctaatgcagaccctaaagcattggacctgttggat
aagatgttgacatttaaccctcataagaggattgaggtggaggaggcgctggctcacccg
tacctggaacagtactatgaccccacagatgagcctgttgcagaggctccatttaagttc
gatatggagctggatgacttgcccaaagagactttgaaagagctgatctttgaagaaact
gcccgcttccaaccaggctacagaccatag

KEGG   Sinocyclocheilus anshuiensis: 107686994
Entry
107686994         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04114  Oocyte meiosis
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04350  TGF-beta signaling pathway
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04520  Adherens junction
sanh04540  Gap junction
sanh04620  Toll-like receptor signaling pathway
sanh04621  NOD-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107686994
   04012 ErbB signaling pathway
    107686994
   04350 TGF-beta signaling pathway
    107686994
   04370 VEGF signaling pathway
    107686994
   04371 Apelin signaling pathway
    107686994
   04068 FoxO signaling pathway
    107686994
   04150 mTOR signaling pathway
    107686994
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107686994
  09143 Cell growth and death
   04114 Oocyte meiosis
    107686994
   04210 Apoptosis
    107686994
   04218 Cellular senescence
    107686994
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107686994
   04520 Adherens junction
    107686994
   04540 Gap junction
    107686994
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107686994
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107686994
   04621 NOD-like receptor signaling pathway
    107686994
   04625 C-type lectin receptor signaling pathway
    107686994
  09152 Endocrine system
   04910 Insulin signaling pathway
    107686994
   04912 GnRH signaling pathway
    107686994
   04914 Progesterone-mediated oocyte maturation
    107686994
   04916 Melanogenesis
    107686994
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107686994
   04270 Vascular smooth muscle contraction
    107686994
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107686994
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107686994
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sanh03036]
    107686994
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107686994
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107686994
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107686994
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107686994
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107686994
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Choline_kinase FTA2
Other DBs
NCBI-GeneID: 107686994
NCBI-ProteinID: XP_016339608
UniProt: A0A671SYY8
LinkDB
Position
Unknown
AA seq 391 aa
MAESGSSAAAAGAAGSNSSTAGAGAVAPVGANGAAGSKPGLESVKGQNFDVGPRYTDLQY
IGEGAYGMVCSAFDHVNKIRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIL
RARRIEYMRDVYIVQDLMETDLYKLLKTQQLSNDHICYFLYQILRGLKYIHSANVLHRDL
KPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSID
IWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSQDDLNCIINMKARNYLQSLPQK
PKVPWSKLFTKADNKALDLLDRMLTFNPIKRITVEEALAHPYLEQYYDPSDEPVAEEPFT
FNMELDDLPKEKLKELIYEETARFQANYQGS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggcggaatcgggcagcagcgcggcggcggccggagccgcgggctcgaatagcagcacc
gccggggctggagccgtcgcgcccgtgggagccaatggagcggcgggatccaagcctggc
ctggagtcggtgaagggacaaaattttgacgttggcccccgatacaccgatctccagtac
atcggggagggggcatatgggatggtctgctcagcttttgatcatgtgaataagatccga
gtggccattaagaagatcagtccatttgaacaccagacctactgccagcgcaccctgagg
gagatcaaaatcctcctgcggttccgtcatgagaacatcattggcatcaatgacatcctg
agagctcgtcgcatcgaatatatgagggatgtctatatcgtacaggacctgatggagacc
gacctttacaaattgctgaagacacagcaactcagcaatgaccatatctgctactttctg
taccagatcctgcgagggctgaaatacattcactctgccaatgtgctgcacagagacttg
aagccttcgaaccttctcatcaacaccacctgtgacctcaagatctgtgactttgggctg
gcacggatagccgacccagaacatgaccacaccggattcctcacagagtatgtggctact
cgctggtatcgtgctcctgagatcatgctcaactccaagggctacaccaaatccattgat
atttggtctgtgggttgcatcctggctgagatgttgtccaacagacccatcttccctggg
aagcattatctggaccagctcaaccacatattgggtgttttgggctccccctctcaagat
gatctgaactgcatcatcaacatgaaggccaggaactacctccaatctctaccccagaaa
ccgaaagtcccatggagcaaactgttcaccaaagcagacaacaaagctctggatttattg
gaccgcatgttgacctttaaccccatcaaacgtataaccgtggaggaagcattggcccac
ccctacctggagcagtactatgacccttctgatgagccggtggctgaggagcctttcact
ttcaacatggagctggacgaccttcctaaagagaagctgaaagagctcatctatgaggag
acggcacgcttccaggccaactaccagggctcctga

KEGG   Sinocyclocheilus anshuiensis: 107690275
Entry
107690275         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04114  Oocyte meiosis
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04350  TGF-beta signaling pathway
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04520  Adherens junction
sanh04540  Gap junction
sanh04620  Toll-like receptor signaling pathway
sanh04621  NOD-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107690275
   04012 ErbB signaling pathway
    107690275
   04350 TGF-beta signaling pathway
    107690275
   04370 VEGF signaling pathway
    107690275
   04371 Apelin signaling pathway
    107690275
   04068 FoxO signaling pathway
    107690275
   04150 mTOR signaling pathway
    107690275
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107690275
  09143 Cell growth and death
   04114 Oocyte meiosis
    107690275
   04210 Apoptosis
    107690275
   04218 Cellular senescence
    107690275
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107690275
   04520 Adherens junction
    107690275
   04540 Gap junction
    107690275
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107690275
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107690275
   04621 NOD-like receptor signaling pathway
    107690275
   04625 C-type lectin receptor signaling pathway
    107690275
  09152 Endocrine system
   04910 Insulin signaling pathway
    107690275
   04912 GnRH signaling pathway
    107690275
   04914 Progesterone-mediated oocyte maturation
    107690275
   04916 Melanogenesis
    107690275
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107690275
   04270 Vascular smooth muscle contraction
    107690275
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107690275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107690275
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sanh03036]
    107690275
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107690275
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107690275
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107690275
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107690275
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107690275
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Choline_kinase FTA2
Other DBs
NCBI-GeneID: 107690275
NCBI-ProteinID: XP_016344046
UniProt: A0A671Q1N5
LinkDB
Position
Unknown
AA seq 392 aa
MAESGSSAAAAGTAGSSSIAAGAGAAVAAGGANGAAGSKPGLESVKGQNFDVGPRYTDLH
YIGEGAYGMVCSAFDNVNKIRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDI
LRARRIDYMRDVYIVQDLMETDLYKLLKTQQLSNDHICYFLYQILRGLKYIHSANVLHRD
LKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSI
DIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQDDLNCIINMKARNYLQSLPQ
KPKIPWSKLFPKADNKALDLLDRMLTFNPIRRITVEEALAHPYLEQYYDPSDEPVAEEPF
TFNMELDDLPKEKLKELIYEETARFQATYQGS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcggaatcgggcagcagcgctgcggcggccggaaccgcgggctcgagtagcatcgcc
gccggggctggagcagccgtcgcggccgggggagctaatggagcggcgggatccaagccc
ggcctggagtcggtgaagggacagaattttgacgttggcccccgatacaccgatctccat
tacatcggggagggggcctatggaatggtctgctcagcttttgataatgtgaataagatc
cgagtggccattaagaagatcagtccgtttgaacaccagacctactgccagcgcaccctg
agggagatcaaaatcctcctgcggttccgtcatgagaacatcatcggcatcaatgacatc
ctgagagcgcgtcgcatcgattatatgagggatgtctacatcgtacaggacctgatggag
accgacctttacaaattgctgaagacacagcaactcagcaacgaccatatctgctacttt
ctgtaccagatcctgcgagggctgaagtacattcactctgccaatgtgctgcacagagac
ttgaagccctcgaaccttctcatcaacaccacctgtgacctcaagatctgtgactttggg
ctggcacggatagccgacccagaacatgaccacaccggattcctcacagagtatgtggct
actcgctggtaccgtgctcctgagatcatgctcaactccaagggctacaccaagtctatt
gatatttggtctgtgggttgcatcctagctgagatgttgtccaacagacccatcttccct
ggaaagcattatctggaccagctcaaccacattttgggtattttgggctctccctctcaa
gatgatctgaactgcatcatcaacatgaaggccaggaactacctccagtctctaccccag
aaaccgaaaatcccatggagcaagctcttccccaaagcagacaacaaagctctggattta
ttggaccgcatgttaacctttaaccccatcagacgtataactgtggaggaagcactggcc
cacccctacctggagcagtactatgacccctctgatgagccggtggctgaggagcccttc
actttcaacatggagctggacgaccttcctaaagagaagctgaaagagctcatctatgag
gagacggcacgcttccaggccacctaccagggctcctga

KEGG   Sinocyclocheilus anshuiensis: 107704570
Entry
107704570         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04114  Oocyte meiosis
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04350  TGF-beta signaling pathway
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04520  Adherens junction
sanh04540  Gap junction
sanh04620  Toll-like receptor signaling pathway
sanh04621  NOD-like receptor signaling pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107704570
   04012 ErbB signaling pathway
    107704570
   04350 TGF-beta signaling pathway
    107704570
   04370 VEGF signaling pathway
    107704570
   04371 Apelin signaling pathway
    107704570
   04068 FoxO signaling pathway
    107704570
   04150 mTOR signaling pathway
    107704570
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107704570
  09143 Cell growth and death
   04114 Oocyte meiosis
    107704570
   04210 Apoptosis
    107704570
   04218 Cellular senescence
    107704570
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107704570
   04520 Adherens junction
    107704570
   04540 Gap junction
    107704570
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107704570
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107704570
   04621 NOD-like receptor signaling pathway
    107704570
   04625 C-type lectin receptor signaling pathway
    107704570
  09152 Endocrine system
   04910 Insulin signaling pathway
    107704570
   04912 GnRH signaling pathway
    107704570
   04914 Progesterone-mediated oocyte maturation
    107704570
   04916 Melanogenesis
    107704570
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107704570
   04270 Vascular smooth muscle contraction
    107704570
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107704570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107704570
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sanh03036]
    107704570
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107704570
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107704570
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107704570
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     107704570
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107704570
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo
Other DBs
NCBI-GeneID: 107704570
NCBI-ProteinID: XP_016363015
UniProt: A0A671RC74
LinkDB
Position
Unknown
AA seq 369 aa
MATAAVSAPAGGGPNPGSGAEMVRGQAFDVGPRYSNLSYIGEGAYGMVCSAYDRDNKVRV
AIKKISPFEHQTYCQRTLREIKILLRFKHENIISINDIIRTPTIDQMKDVYIVQDLMETD
LYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLA
RVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGK
HYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFPNADPKALDLLD
KMLTFNPHKRIEVEEALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKETLKELIFEET
ARFQPGYRP
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggcgacagctgcggtatctgcccctgctggcggcggcccgaaccccggatccggtgcc
gagatggtccgcggtcaggctttcgacgtcgggccgcgctacagcaacctctcgtacatc
ggagaaggcgcatacggcatggtttgctcggcatatgatcgtgataataaagtgcgtgtg
gcgataaagaaaatcagtccgtttgagcaccagacatactgtcagcgcacactccgtgag
attaaaatcctgctccgcttcaagcacgagaacatcatcagcatcaacgacattatccgc
actcccaccatcgaccagatgaaagacgtctacattgtacaggatctgatggagacggac
ttgtacaagctgttgaagacgcagcacttgagcaatgaccacatctgttacttcctgtac
cagatcttgcgcggcctgaagtacatccactcggcaaacgttctccacagagacctgaag
ccatctaacctgttgctcaacactacttgcgacctcaagatctgtgattttgggcttgcc
cgggtggccgatccagaccatgaccacaccggcttcctgacggagtatgtagccacgcgt
tggtaccgcgcaccagagattatgctcaattctaagggttacactaagtccattgatata
tggtcggtcggttgtattctggctgagatgctttcgaatagacccatcttccctgggaaa
cactatctggaccagcttaaccacatcttaggtattttgggctccccctctcaggaggat
ctcaactgcattatcaacattaaggcgagaaattacctgttgtcacttcctctccgctgc
aaagtgccctggaaccgcctgtttcctaacgccgaccctaaagcgttggacctgttggat
aagatgttgacctttaaccctcataagaggattgaggtggaggaggcgctggctcacccg
tacctggagcagtactatgatccctcagatgagcctgttgctgaggctccgtttaagttc
gatatggagctagatgacttgcccaaagagactttgaaagagctgatctttgaagaaact
gcacgcttccaaccaggctacagaccatag

DBGET integrated database retrieval system