KEGG   Sinocyclocheilus anshuiensis: 107669198Help
Entry
107669198         CDS       T04917                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00562  Inositol phosphate metabolism
sanh01100  Metabolic pathways
sanh04068  FoxO signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04115  p53 signaling pathway
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04218  Cellular senescence
sanh04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107669198
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107669198
   04070 Phosphatidylinositol signaling system
    107669198
   04150 mTOR signaling pathway
    107669198
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107669198
  09143 Cell growth and death
   04115 p53 signaling pathway
    107669198
   04218 Cellular senescence
    107669198
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107669198
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107669198
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107669198
    3.1.3.48  protein-tyrosine-phosphatase
     107669198
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     107669198
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    107669198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 107669198
NCBI-ProteinID: XP_016316820
LinkDB All DBs
Position
Unknown
AA seq 422 aa AA seqDB search
MAAIIKEIVSRNKYRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDKWLSENDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFKKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNKLEYKPVALLFHKMVFETVPMFSGGTCRDSAVKSKSEQIPHGFRKTNWHWDPQFVV
YQLKVKIHTSNPAHTRREEKYMYFDFPQLLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPEESLEKVENGGLVKERDGIQTTERGENDKDYLILTLTKNNLDKANKDKANRYFS
PNFKVKLYFTKPVEEPSNSEASTSTSVTPDVSDNEPDHYRYSDTTDSDPENEQYDEEQIT
KV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgatcataaaggaaattgtcagccgaaacaaatatagataccaggaagatgga
ttcgacttggacttgacctatatttatcctaacattatagcaatgggctttcctgctgaa
agacttgagggtgtctacagaaacaacatagatgatgtagtgcgattcctggattcaaag
cataaaaatcattacaagatatataatctatgtgcggaaagacattatgatactgccaaa
tttaactgcagagttgcacagtatccgtttgaggatcacaatcctcctcagctagaactc
attaaacctttctgtgaagatctggataagtggctcagtgaaaatgacaatcatgtggct
gccattcactgcaaagctggaaagggacgtacgggtgtcatgatatgtgcgtacttgtta
caccgaggcaaattcaaaaaagcacaagaggctctggacttctatggtgaagttagaacc
agagacaagaagggagtgactattcccagtcagaggcgatatgtgtactactatagctac
cttctgaagaataagctggagtacaaaccagtggccttgctgtttcacaagatggtgttt
gagactgtgcctatgttcagtggagggacctgcagggattctgctgtaaaaagcaagagt
gagcagattccgcatgggttcagaaaaaccaattggcattgggatcctcagtttgtggtg
taccagctgaaggtgaaaatccacacgtctaacccagcgcacacaaggcgagaggagaag
tacatgtactttgattttccgcagctgctgcctgtgtgtggagacatcaaggtggagttc
ttccacaagcagaacaagatgatgaaaaaggataagatgtttcacttctgggtgaacacc
ttcttcatccctggaccagaggaaagcttggagaaggttgaaaacggaggtttagtgaag
gaacgggatgggatccaaaccacggaacggggagagaatgacaaggattatctaatcctg
actttaaccaagaacaacttggataaagccaataaggataaagccaacagatacttctct
ccaaacttcaaggtgaagctgtacttcacaaagccagtggaggaaccatccaactcggag
gccagcacttctacatctgtaacaccagatgttagcgataatgaaccggaccattaccgg
tattcggacacaacagactcggaccctgaaaatgaacagtatgatgaagaacagattact
aaagtttga

DBGET integrated database retrieval system