KEGG   Sinocyclocheilus anshuiensis: 107671615Help
Entry
107671615         CDS       T04917                                 

Gene name
erg
Definition
(RefSeq) LOW QUALITY PROTEIN: transcriptional regulator ERG
  KO
K09435  transcriptional regulator ERG
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sanh03000]
    107671615 (erg)
Transcription factors [BR:sanh03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    107671615 (erg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT SAM_1
Motif
Other DBs
NCBI-GeneID: 107671615
NCBI-ProteinID: XP_016320010
LinkDB All DBs
Position
Unknown
AA seq 442 aa AA seqDB search
MASTIKEALLVVSEDQSLFECSYGAPHSKTDMTASAAGEYGPSKLSPRVHQQDWLAPPTG
RVTVKLECGAGAQVSGSRXDAPPEQERVSPVMYSSFMEDKHAAPPNLTTRERRVIVPADP
SLWSADHVRQWLEWAVKEYGLPEVDLSLFHSIDGKELCKMSKDDVQRLTSSYTAEILLSH
LHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGASFIFPNTYPSDGSRADVSFHSRRS
GWTQPASAAKVAITSKTQEQRAQCVCVCVSGSGQIQLWQFLLELLSNSSNSSCITWEGTN
GEFKMTDPDEVARRWGERKSKPNMNYDKMSRAMRYYYDKNIMTKVHGKRYAYKFDFHGIA
QALQPHPPDSSIYKYPAELSYMSSYPHPQKMSFVSPHTQAMNAASSGFFGGPGPYWNAPV
AGIYSGPRHPAAHMPSHLGSYY
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaccatcaaggaggcgctgttggtggtgagtgaggatcagtctttattcgag
tgttcatacggagcgcctcattctaagacggacatgacggcctccgccgccggcgaatac
ggcccgagcaaactcagtcccagagtgcatcagcaggactggctggctccgcccaccgga
cgtgtcaccgtcaagctggagtgcggcgcgggagcacaggtgagcggatccaggtgagac
gcacctccagagcaggagagagtttctccagtgatgtacagcagctttatggaggacaaa
cacgcagcgccacccaacttgaccaccagggagcgcagagtgatcgtacctgcagatccg
agcctgtggtcggcggatcacgtgcgtcagtggctggaatgggccgtgaaggagtacggg
cttcccgaggtggacctgtctctcttccacagcatcgacgggaaggagctctgcaagatg
agcaaagacgatgtccagcgcctgacaagcagctacacggccgagatcctgctgtctcac
ctgcactacctcagagagactccacttcctcacttgacttcagatgatgttgacaaagcc
ttgcaaaactccccgcggttaatgcatgctcgcaatacaggaggagccagcttcatcttc
ccaaacacctacccttcagacggcagcagagcagacgtgagtttccacagccggcgctct
ggatggactcagccggcgtctgcagctaaagttgccatcacgagcaaaacccaagagcag
agagctcagtgtgtgtgtgtgtgtgtttcaggttcgggtcagatccagctgtggcagttc
ctcctggagcttctctccaacagctccaactcgtcctgcatcacgtgggaaggaaccaac
ggcgagttcaagatgacggatccggacgaggtggcgcggcgctggggcgagaggaagagc
aagcccaacatgaactacgacaagatgagccgagccatgcgctactactacgacaagaac
atcatgaccaaagtgcacggcaagcgctacgcctacaagtttgacttccacggcatcgca
caggccctgcagccgcatccgcccgactcctccatctacaagtaccccgccgagctgtcc
tacatgagctcgtacccgcacccgcagaagatgagcttcgtgtctccacacactcaggcc
atgaacgccgcctcgtccggcttcttcggcggcccgggtccgtactggaacgctccggtg
gcgggaatctacagcggaccgcgacaccccgctgcgcacatgccctcgcatctgggctcc
tactactag

DBGET integrated database retrieval system