KEGG   Sinocyclocheilus anshuiensis: 107672044
Entry
107672044         CDS       T04917                                 

Definition
(RefSeq) NF-kappa-B essential modulator-like isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04210  Apoptosis
sanh04620  Toll-like receptor signaling pathway
sanh04621  NOD-like receptor signaling pathway
sanh04622  RIG-I-like receptor signaling pathway
sanh04623  Cytosolic DNA-sensing pathway
sanh04625  C-type lectin receptor signaling pathway
sanh04920  Adipocytokine signaling pathway
sanh05132  Salmonella infection
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107672044
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107672044
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107672044
   04621 NOD-like receptor signaling pathway
    107672044
   04622 RIG-I-like receptor signaling pathway
    107672044
   04623 Cytosolic DNA-sensing pathway
    107672044
   04625 C-type lectin receptor signaling pathway
    107672044
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107672044
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107672044
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107672044
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107672044
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107672044
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 DUF1241 DUF1216 Cas_GSU0053
Other DBs
NCBI-GeneID: 107672044
NCBI-ProteinID: XP_016320613
LinkDB
Position
Unknown
AA seq 606 aa
MVQPQPSGGCTLQWELTGEETVGARGQGSLMASSQGSMGVPPELVGNEVVHRLITDNHQL
REALKRSNDALKERCDEMEGWQRRSREEREFLSCRFREARALVQRLAQENQSLLGQLNHS
ISQTGSPSVGITKETGNQGQDQELKCTNVEKNVLMDSPEVLNEAVLTDRAEGDADRHTMP
QSLPAEGSNEFLKLLKSHKEKLEEGMRALRRRNEELEKEKTENEKERENLLATVEQLRSK
LNQNGGVTEESVQQACALTVPAESSHLAKLTEQLQATQGRYRELQEKLDCLQKSSVQRDR
NEALLKQKEKDFVQLTKDSEALRAQVTSLLGELNERQNWLEKSEAERRILEDKLGKKTER
LQTLERDMEQQKKQHSVTVDNLLLQTQNLETALKNERLVIVEERRKLAQLQHAYTCLFQD
YDKKLKSEKQANHRCGEADTLVNRLAEAEKALALKQDLIDKLKEETEQLRAALETIPVLN
AQAEIYKMDFLAEREAREKLNQKKEELQEELSKALVEIDRLKQEGTSRARIEEMQQRHLE
DYRPRPHPPPPAAPFAGAAMFNPAQPPSARRRDEDQDGLPDYCCPKCMYKAPDMDTLQIH
VMDCIQ
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggtccagccgcagccgtcaggtggttgtactctgcagtgggagctgactggagaggag
actgtgggtgccaggggtcaagggtcacttatggccagttcacaggggtctatgggggtc
cctcctgaattagtgggaaatgaagtggtccatagactcataacagataatcatcagcta
cgagaggctctgaagcgaagcaatgatgccctcaaagaaagatgtgatgagatggagggg
tggcagaggaggtcgagagaggagcgcgagttcctgagctgtagatttcgtgaggccaga
gctttagtgcagcgactggcacaggaaaaccagagcctgttgggacagctcaaccacagc
atcagtcaaacagggagtccaagtgttggcatcactaaagagactggaaatcaaggccag
gaccaagagctgaagtgcactaatgtagagaagaatgtcctcatggactcaccagaagta
ttaaatgaagctgtactgacagaccgagctgaaggagacgctgacagacacacaatgcct
caaagtttgcctgctgagggctctaatgaatttctgaaactgctgaaaagccacaaagag
aagctggaggaagggatgagggcactgaggaggaggaatgaggagctggagaaggagaag
acagagaatgagaaagagagagaaaatctcctcgccactgtagagcagttacgctccaaa
ctcaatcagaatggtggtgttactgaagagtcagtccagcaggcatgcgcgctcaccgtt
cctgcagaaagctctcacttggctaaactaactgagcagcttcaggctacacaaggcagg
tacagggagctccaggagaagctggactgtcttcagaagagctctgttcagagagacaga
aatgaggctctactcaaacagaaggagaaggactttgttcagctgacaaaggatagtgaa
gctctgagagctcaggtcacgtcccttctcggtgagttgaatgaacgacaaaattggctg
gagaaaagtgaagcagagagacgaattttagaggataagttgggcaagaagaccgaacgc
ctgcagactttagagagagacatggagcagcagaagaagcagcacagtgtgacagtggac
aatcttttactgcagacacagaacctagaaactgcactgaagaacgagaggctcgtcata
gtggaggagaggaggaagctggcccagctccaacatgcgtacacatgtttgtttcaggat
tatgacaaaaaactcaaaagtgaaaagcaagccaatcacaggtgtggagaggcagatact
ctagttaacaggttagcagaggctgagaaagctctggccctgaaacaggatctcatcgat
aaactcaaggaggaaacagagcagctgagagctgcattagagactataccagtgctgaat
gctcaggcagagatctataagatggacttcctggctgagagggaagccagagagaaactc
aatcaaaagaaggaagagttgcaggaggagctgagtaaggcactagttgagatagacaga
ctcaagcaagaaggaacctcaagagctcgcattgaagagatgcaacagagacatttggag
gactacaggcctcgtccacacccacctcctccagccgcacctttcgcaggagcagccatg
tttaaccccgcccaacctccatctgcacgcagaagagacgaagatcaagacgggctgcct
gattactgctgtcccaaatgtatgtacaaggctccagacatggacaccctgcagattcac
gtcatggactgtatccagtga

DBGET integrated database retrieval system