KEGG   Sinocyclocheilus anshuiensis: 107672476Help
Entry
107672476         CDS       T04917                                 

Definition
(RefSeq) procollagen galactosyltransferase 1-like
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00310  Lysine degradation
sanh00514  Other types of O-glycan biosynthesis
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107672476
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107672476
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sanh01003]
    107672476
Enzymes [BR:sanh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     107672476
Glycosyltransferases [BR:sanh01003]
 O-Glycan biosynthesis
  O-linked Gal type
   107672476
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1 CAP59_mtransfer
Motif
Other DBs
NCBI-GeneID: 107672476
NCBI-ProteinID: XP_016321165
LinkDB All DBs
Position
Unknown
AA seq 618 aa AA seqDB search
MFVKSVCSTMLWFVLFVSVLWSCLMNTGPAQGYFHEERWSPESPILAPRVMIALICRNAQ
HSLPHFLGTIERLDYPKDQIALWVATDHNIDNTTYLLRDWLISVQKLYHYVEWRPKEEPR
KYHDEEGPKDWTNERYAYVMKLRQAALESAREMWADYLMMIDCDNLLINRDVLWKLIKEN
KTVVAPMMESRAAYSNFWCGMTSQGYYKRTPAYIPMRKQVRRGCFAIPMVHSTFLVDLRK
EASRLLAFHPPHPDYTWAFDDIIVFAFSARMAEVQMFICNKETYGHLPVPLRAHSTMQDE
ADSFIHTLLEVNVRNPPVEPSRYLPKPVKRPDKMDFDEVFMINLKRRADRRECMLRALRE
QEIDCKIIAAVDGKAMNVSEIHAMGVHMLPGYSDPYHGRPLTRGEMGCFLSHYNIWKEIV
DRGLKTSLVLEDDLRFEIFFKRRLQNLMREVESKGLDWDLIYIGRKRMQVDRPEKAVPNI
RNLVEADYSYWTLGYMMSLQGAKKLLKAEPISKMLPVDEFLPIMFNKHPVSDYMDQFETR
DLKAFSAEPLLVFPTRYTGEPGYISDTETSTVWDNETVRTDWDRKHSGKTREQAEISTEA
QNSDVLQSPLDRTARDEL
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtaaagagtgtgtgcagtacaatgctctggttcgtgttgttcgtgtcggtgctg
tggtcctgtctgatgaatactggaccagctcaaggatacttccacgaagagcgctggagc
ccggagtctccgatattagctccccgagtaatgatcgctctcatctgccgtaacgcccag
cactcgctgccacatttcctcggtactatcgagcgcctcgattaccctaaagaccagatc
gcgctgtgggtggcaaccgaccacaatattgacaacactacttacctactgcgagactgg
ctcatcagtgtacagaaactctaccattatgtggagtggaggccaaaggaggaaccaaga
aaatatcatgatgaggaaggaccaaaggattggacgaatgagcgctacgcctacgtcatg
aaactgcggcaggcagcacttgagtctgcacgagagatgtgggcagactatctcatgatg
attgattgtgataatctcctgatcaaccgagacgtcttatggaaactaataaaggagaac
aagacggttgtggcaccaatgatggagtctcgtgctgcctactcaaacttctggtgtgga
atgacatcccagggctactataaacgaacccctgcctacatccccatgcgcaagcaagtg
cgtaggggttgctttgccattcccatggtgcactcgactttcctggttgacctgcggaaa
gaagcttccagactgcttgcttttcacccaccacatccagactacacctgggcctttgac
gacattatagtctttgctttttcagcccgcatggcagaggtacaaatgtttatttgtaac
aaggagacttatgggcatctgccagtgcctcttcgtgcccacagcaccatgcaggatgaa
gctgacagctttattcatactttgctggaggtcaatgtgcgaaatcctccagttgagcct
tccagatacttgcccaaacctgtcaaaagacctgacaaaatggactttgatgaggtattt
atgatcaacctgaaaaggcgggccgaccggcgtgagtgcatgctgagggcgctgagagag
caagaaatcgactgcaagattatagcagctgttgatggcaaagctatgaacgtcagtgag
atccatgctatgggagtccacatgcttcccggctacagtgacccctaccatggcagacct
ctgacgagaggagagatgggctgcttcctgtcccactataacatctggaaagagattgta
gacagaggcctgaagacctcgctggtgcttgaagatgatttgcggtttgagattttcttc
aagcgccgcctacagaatctgatgcgtgaggtggagagtaagggtctggactgggacctc
atttatattgggaggaagaggatgcaagtggaccgacctgagaaggcagtaccaaacatt
cgcaacctggtggaggcggactattcctattggaccttgggctacatgatgtcattacaa
ggagccaaaaagctcctcaaagcagaaccaatcagtaaaatgttgcctgtggacgagttc
cttcctattatgtttaataagcatcctgtatcggattacatggatcagtttgagacgagg
gacctgaaagcattttcagcggagcccttgcttgtgtttcctacacgctacacaggtgaa
cctgggtatatcagtgacacagaaacctccacagtgtgggacaatgagacagtgcgcaca
gactgggacaggaagcactcgggtaaaacccgggaacaggctgagatcagcacagaggcc
caaaactcagatgtgctccagtctcctctggacagaacagctcgagacgaactatga

DBGET integrated database retrieval system