KEGG   Sinocyclocheilus anshuiensis: 107672669Help
Entry
107672669         CDS       T04917                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00250  Alanine, aspartate and glutamate metabolism
sanh00410  beta-Alanine metabolism
sanh00430  Taurine and hypotaurine metabolism
sanh00650  Butanoate metabolism
sanh01100  Metabolic pathways
Module
sanh_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107672669
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107672669
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107672669
   00430 Taurine and hypotaurine metabolism
    107672669
Enzymes [BR:sanh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107672669
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Chlam_OMP3
Motif
Other DBs
NCBI-GeneID: 107672669
NCBI-ProteinID: XP_016321445
LinkDB All DBs
Position
Unknown
AA seq 565 aa AA seqDB search
MASSAPSSSAADMDPNTANLRQSATSFLQKNNSLDEKSRMVGAFKESAKNQMCDNSERFT
RAETDFSNLFARDLLPAKNGEEPTIQFLLEVVEILTNYVRKTFDRSTKVLDFHHPHQLLE
GMEGFNLELSDQPESLEQILVDCRDTLKYGVRTGHPRFFNQLSSGLDIIGLAGEWLTSTA
NTNMFTYEIAPVFVLMEQLTLKKMREIIGWPNGDGDGLFSPGGAISNMYSVMVARYKYFP
EVKTKGMSAAPRLVLFTSEHSHYSIKKAGAVLGFGKENVILLKTDERGRVIPADLEAKII
DAKQKGYVPLFVNATAGTTVYGAFDPINDIADICEKYNLWLHVDGAWGGGLLMSRKHRHK
LSGIERANSVTWNPHKMMGVPLQCSAILVREKGILQGCNSMCAGYLFQPDKQYDVNYDTG
DKAIQCGRHVDIFKFWLMWKAKGTTGFEQHIDRCLEISEYLYNKIKNREGYEMVFEGQPQ
HSNVCFWYIPPSLRGMPDGDERREKLHRVAPKIKAMMMECGTTMVGYQPQGDKVNFFRMV
VSNHAVTKSDIDFLIDEIERLGHDV
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttctgcaccttcttcctcggctgctgatatggacccaaacacggctaattta
cgacaatctgccacaagtttcctgcagaagaacaacagtctggatgagaagagtcggatg
gtgggcgccttcaaggagagcgcaaagaaccagatgtgtgacaacagcgagcgcttcacg
cgcgcagagacagacttctccaacctgttcgctcgagatctgctgcctgctaaaaatggc
gaggagcccacaatccagtttcttcttgaggttgtggagatcctcaccaattatgtgcgc
aagacctttgacagatccaccaaagtgctggacttccatcaccctcaccagctcctggag
gggatggagggcttcaacctggagctgtctgaccaaccagagtcgctggagcagatcctg
gtggactgcagagacacgctcaagtatggagtcagaacaggtcatcctagattcttcaat
cagctttcatctggtctggatatcatcggtctggctggagaatggctcacctctactgcc
aacactaacatgttcacatatgaaatcgctcctgtgtttgttctgatggagcaactgacc
ctcaagaagatgagagagatcattggctggcctaatggtgatggcgatggactcttctcc
ccaggtggtgccatatcaaacatgtacagtgtgatggttgcacggtacaagtatttccct
gaagtcaaaaccaaaggcatgtctgcagcaccacgactcgtgcttttcacttctgaacat
agtcattattcaatcaaaaaggcaggagcagtactgggatttggcaaagaaaacgtaatt
cttctgaagacagatgagagggggcgtgtcatacctgctgacttagaggccaagatcatt
gatgccaaacagaagggttacgtgccactgtttgtgaatgcaacggctggtaccacagta
tatggagcattcgatcccatcaatgacattgcagacatctgtgagaagtacaacctgtgg
ttacatgtggatggtgcatggggcggaggactgttgatgtccaggaaacaccgtcacaag
ctaagcggcattgagagagcaaactcagtcacatggaaccctcataagatgatgggtgta
ccattgcaatgttcagccatcctggttagagagaagggcattctgcagggctgcaactcc
atgtgcgctggatacctcttccaaccagacaaacagtacgatgtgaactacgacaccggc
gacaaggccatccagtgtggcagacatgtagacatcttcaaattctggctcatgtggaag
gccaagggcacaactgggtttgagcagcacattgacagatgtctggagatttctgaatat
ctctacaacaaaatcaagaaccgtgagggatatgaaatggtctttgagggccagccccag
cactcaaatgtttgcttctggtatattccaccaagcttgcgtggcatgccagatggagac
gaaagaagggagaaactacacagggtggcaccgaagatcaaagcaatgatgatggagtgc
ggcacaaccatggtaggataccagccacaaggagacaaggtcaacttcttccgaatggtt
gtctccaatcacgccgtcaccaagtccgacatcgatttcctcatcgatgagatcgagagg
ctgggtcacgacgtttaa

DBGET integrated database retrieval system