KEGG   Sinocyclocheilus anshuiensis: 107672786
Entry
107672786         CDS       T04917                                 

Definition
(RefSeq) cellular tumor antigen p53-like isoform X1
  KO
K04451  tumor protein p53
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04110  Cell cycle
sanh04115  p53 signaling pathway
sanh04137  Mitophagy - animal
sanh04210  Apoptosis
sanh04216  Ferroptosis
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107672786
   04310 Wnt signaling pathway
    107672786
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107672786
  09143 Cell growth and death
   04110 Cell cycle
    107672786
   04210 Apoptosis
    107672786
   04216 Ferroptosis
    107672786
   04115 p53 signaling pathway
    107672786
   04218 Cellular senescence
    107672786
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107672786
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sanh03000]
    107672786
   03036 Chromosome and associated proteins [BR:sanh03036]
    107672786
   03400 DNA repair and recombination proteins [BR:sanh03400]
    107672786
Transcription factors [BR:sanh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    107672786
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     107672786
DNA repair and recombination proteins [BR:sanh03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107672786
SSDB
Motif
Pfam: P53 P53_tetramer
Other DBs
NCBI-GeneID: 107672786
NCBI-ProteinID: XP_016321634
UniProt: A0A671M4J8
LinkDB
Position
Unknown
AA seq 371 aa
MAESQEFADLWERNLISTQEGGPCWDLINDEQYLPGSFDLNIFSNVLTEQPQPSTSPPTA
SVPVATDYPGEHGFKLGFPQSGTAKSVTCTYSADLNKLFCQLAKTCPVQMVVDVAPPQGS
VIRATAIYKKSEHVAEVVRRCPHHERTPDGDALAPPAHLIRMEGNSRAVYREDDITYRHS
VVVPYEAPQLGAEWTTVLYNFMCNSSCMGGMNRRPILTIITLETHEGQLLGRRSFEVRVC
ACPGRDRKTEESNFRKDQETKTLGKTPSTTKRSMTKESSSSTPRPEGRRKAKLSTSSDEE
IYTLQVRGKERYEMLKKINDSLELSDVVPPSDMDRYRQKLFTKGKKEKDGQTPEPKRGKK
LMVKDEKSDSD
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcagaaagtcaagaatttgctgacctgtgggagcgaaacctcatttccactcaggaa
ggtggcccttgctgggacttgatcaatgatgagcagtatcttccaggctctttcgacctg
aatatttttagtaatgtgctgactgaacagcctcagccgtccacctcccctccgaccgcc
tctgttcctgttgccactgattatcctggggagcatggcttcaaactgggcttccctcaa
tctggcaccgccaagtctgtcacctgcacgtactcggctgacctgaataagctcttttgc
caattggcgaaaacgtgtccagttcagatggtggtggacgttgcccctccccagggctcg
gtgatcagagccacagccatttataagaagtccgaacatgtggctgaggtggtccgtcga
tgtccccaccatgagagaaccccagatggcgatgcattggctcctcctgctcacctgatc
cgaatggaaggaaactcgcgtgctgtttacagagaggacgacataacctacaggcacagt
gtggtggttccctatgaagctcctcaactgggagcagaatggacaactgttttgtacaat
ttcatgtgcaacagcagttgcatgggtggcatgaaccgccgacccatcctcacaatcatc
actctggagactcatgaaggtcagttgctgggccgcaggtctttcgaggtgcgtgtgtgt
gcgtgcccaggcagagaccggaaaactgaggagagcaacttcaggaaagaccaggagacc
aaaaccttgggcaagaccccttctaccaccaaacgcagcatgactaaagaatcatcttca
tccacacctcgacctgagggcaggaggaaggccaaactgagcacgagcagtgatgaggag
atctataccctgcaggtgaggggtaaggaaaggtatgaaatgttgaagaagattaacgac
agtttggaattgagcgacgtggtacctccatctgatatggacagataccggcagaaatta
ttcaccaagggcaagaaggagaaggatggccaaacgcctgagcccaaaagaggcaaaaaa
ctaatggttaaagatgaaaaaagtgactcggattag

KEGG   Sinocyclocheilus anshuiensis: 107687672
Entry
107687672         CDS       T04917                                 

Definition
(RefSeq) cellular tumor antigen p53 isoform X1
  KO
K04451  tumor protein p53
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04110  Cell cycle
sanh04115  p53 signaling pathway
sanh04137  Mitophagy - animal
sanh04210  Apoptosis
sanh04216  Ferroptosis
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107687672
   04310 Wnt signaling pathway
    107687672
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107687672
  09143 Cell growth and death
   04110 Cell cycle
    107687672
   04210 Apoptosis
    107687672
   04216 Ferroptosis
    107687672
   04115 p53 signaling pathway
    107687672
   04218 Cellular senescence
    107687672
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107687672
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sanh03000]
    107687672
   03036 Chromosome and associated proteins [BR:sanh03036]
    107687672
   03400 DNA repair and recombination proteins [BR:sanh03400]
    107687672
Transcription factors [BR:sanh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    107687672
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     107687672
DNA repair and recombination proteins [BR:sanh03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107687672
SSDB
Motif
Pfam: P53 P53_tetramer
Other DBs
NCBI-GeneID: 107687672
NCBI-ProteinID: XP_016340587
LinkDB
Position
Unknown
AA seq 371 aa
MAESQEFADLWERNLISTQEAGTCWELISDEQYLPSSFDPNIFDNVLTEQPQPSTSPPSA
SVPVATDYPGEHGFKLGFPQSGTAKSVTCTYSSDLNKLFCQLAKTCPVQMVVEVAPPQGS
VIRATAIYKKSEHVAEVVRRCPHHERTPDGDGLAPAAHLIRVEGNSRALYREDDVNSRHS
VVVPYEAPQLGAEFTTVLYNFMCNSSCMGGMNRRPILTIITLETHDGQLLGRRSFEVRVC
ACPGRDRKTEESNFRKDQETKTLGKTPSANKRSLTKESTSSVLRPEGSKKAKLSGSSDEE
VYTLQVKGKDRFEMLKKINDSLELSDVVPPSEIDKYRQKLLTKGKKEKDGQTPEPKRGKK
LMVKDEKSDSD
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggcagaaagtcaagaatttgctgatctgtgggagagaaacctcatttccactcaagaa
gccggcacttgctgggaattgatcagtgatgagcagtatcttccaagctccttcgatcca
aatatttttgataatgtgctgactgaacagcctcagccgtccacctcccctccgtccgcc
tctgttcctgttgccactgattatcctggggaacatggcttcaaactggggttcccgcaa
tctggcaccgccaaatctgtgacctgcacttactcatctgatctgaataagcttttttgc
caattggcgaaaacttgtccagttcagatggtggtggaagttgcccctccgcagggctcg
gtgatcagagccacagccatttataagaagtccgaacacgtggctgaggtggtccgtcga
tgtccccaccatgagagaaccccagatggtgatggattggctcctgctgctcacctgatc
cgagtggaaggaaactcacgtgctctttacagggaggatgatgtcaactcaaggcacagt
gtggtggttccctacgaagctcctcaactgggagcggagtttacaacggtgctatacaac
tttatgtgcaacagcagttgcatgggtgggatgaatcgccggcccatcctcacaatcatc
actctggagactcatgacggtcagttgctgggccgcaggtctttcgaggtgcgtgtgtgc
gcgtgcccaggcagagaccgaaaaactgaggagagcaacttcaggaaagaccaggagacc
aaaaccttgggcaagaccccctctgctaataaacgtagtttgacgaaagagtcaacttca
tctgtgcttcgacctgagggcagtaaaaaggccaaactgagtgggagcagtgatgaagag
gtgtataccctgcaggtgaagggtaaagacagatttgaaatgttgaagaagattaacgac
agtttggagttgagcgatgtggtgcctccatctgaaattgacaaataccggcagaaatta
ctcaccaagggcaagaaggagaaggatggccaaacacctgagcccaaaagaggcaaaaaa
ctaatggttaaagatgaaaaaagcgactctgattag

DBGET integrated database retrieval system