KEGG   Sinocyclocheilus anshuiensis: 107672989
Entry
107672989         CDS       T04917                                 

Definition
(RefSeq) protein kinase C gamma type-like
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04150  mTOR signaling pathway
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04510  Focal adhesion
sanh04540  Gap junction
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107672989
   04012 ErbB signaling pathway
    107672989
   04310 Wnt signaling pathway
    107672989
   04370 VEGF signaling pathway
    107672989
   04020 Calcium signaling pathway
    107672989
   04070 Phosphatidylinositol signaling system
    107672989
   04150 mTOR signaling pathway
    107672989
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107672989
   04540 Gap junction
    107672989
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107672989
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107672989
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107672989
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107672989
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107672989
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like APH
Other DBs
NCBI-GeneID: 107672989
NCBI-ProteinID: XP_016321873
LinkDB
Position
Unknown
AA seq 693 aa
MSTPVSPSLSPLALSSPSPSSSPLPSPLSPPPRLPVFQRKGALKHKRVIEVKDHQFTARF
FKQPTFCSHCTDFIWGIGKQGFQCQVCSFVVHRRCHEFVTFTCPGAITAPKAEDLKSKHK
FKVHTYSSPTFCDHCGSLLYGLIHQGMKCASCDMNVHKRCESSVPSLCGHDHTEKRGRIR
LTVRGEKEDIYVSVHEAYNLIPMDPNGLSDPYVKLKLIPDPKSQSKQKTKTIRSTLNPIW
NESFTFSVHGRQWDRRLSIEVWDWDRTSRNDFMGALSFGVSEIFRRSVSGWFKLLNQDEG
EYYNIPVPDPDLQVPDAALMPSVPLAPVTVTTPVPTVTPPALSPTPTALHTGKGQVRLHD
FNFLMVLGKGSFGKVLLAEERGSERLFAVKVLKKDVLFQDEDTESAMVERRVLGLVGRPH
FLTSLYCAFQTEDRLYYIMEYVNGGDLMFHIQIVGKFKEPHAAFYAAEIAVGLFFLHNKG
IIYRDLKLDNVLLDSKGHIKIADFGMCREGMMEGDTTRTFCGTPDYIAPEIVAYQPYGKA
VDWWSYGVLLYEMLAGQPPFDGIDEEELFQSIMEQSVSYPKSLSREAVAICKGLLTKNPA
KRLGGGEDAERELREHPFFRWIDWDRLERLEIQPPFKPRSGGRKGENFDHFFTSAPSALT
PSDPDVLAAISQEEFQGFTYNNPEFPPSPLTAV
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgtctaccccagtctctccatctctgtctcccctggccctgtcctccccatctccctcc
tcctccccgctcccctctcctctttctcctccccccaggctgccagtcttccagaggaag
ggagctctcaagcacaagagggtcattgaagtgaaggaccaccagttcacagcccgattc
ttcaagcagcctactttctgcagccactgcactgacttcatctggggaattggaaagcaa
ggattccagtgtcaagtgtgcagttttgtggtgcacagacgctgccatgagtttgtcact
tttacttgtcccggagccatcactgctcccaaagcagaggatctcaagagcaaacacaag
tttaaagtacatacatactccagtcccaccttctgtgatcactgtgggtctctgctctac
ggcctcatacatcagggcatgaaatgtgccagttgtgacatgaatgtacacaagcgctgt
gagagcagtgtccccagcctgtgcggacacgaccacactgagaaaagaggacggattcgc
ctgaccgtgcgtggagagaaagaagacatatatgtttcagtgcacgaagcatataacctg
atacccatggaccctaacggcctgtcggacccttatgtgaagctcaaactcatccctgat
ccaaagagccagagcaaacagaaaaccaaaaccatccgttctacactcaaccctatctgg
aacgagagcttcaccttttcagtgcatgggaggcagtgggacaggcgtttgtctatagag
gtctgggactgggatcggacctcacggaatgacttcatgggcgctctgtcgttcggcgtt
agtgagatattcagacgatcagtcagcggctggttcaaactactcaaccaggatgaggga
gagtattataacatccctgtacctgacccagacctgcaggtaccagatgctgctctcatg
ccctctgttcctcttgctcctgttactgtgacgacgcctgttcctactgtgacccctcct
gctcttagtccaactcccactgcactgcacacgggcaaaggccaagtcaggctgcatgat
ttcaacttcctcatggttctgggcaaagggagttttggcaaggtcctgttggcagaggag
aggggcagcgagcgcttgtttgcggtgaaggtgttgaagaaagatgtgctctttcaggat
gaggacacagagagcgccatggtggagagaagagtgctgggcctcgtggggcgacctcac
ttcctgacctccctctactgcgcctttcaaaccgaggatcgtctgtattacatcatggag
tacgtgaacggtggtgatcttatgtttcatatccaaatcgttggcaagtttaaagaaccg
catgcagcgttctatgctgctgagatagcagtgggtctgttcttcctgcacaacaaaggc
atcatatacagagatctaaagctggacaatgtcctgctggacagtaaaggacacataaag
atagcagactttgggatgtgtagggaaggcatgatggaaggggacaccactcggaccttc
tgtggcacacctgattacatcgcacctgagattgtggcgtatcagccgtatggtaaagca
gtggactggtggtcatatggagtcctcctctatgagatgctggctgggcagcctcctttt
gatggcatagatgaggaggagctgtttcagtccatcatggaacagagcgtttcatatcct
aagagtctctctcgggaggctgtggccatctgcaaagggctcctcaccaagaaccctgct
aagcgtttgggtggaggagaggatgcagagagagagctgcgggagcatccttttttccgc
tggatagactgggaccggctggagagactggagatacagcctcccttcaaacccagaagt
ggaggcagaaaaggagagaactttgatcattttttcacatccgccccctctgccctcacg
ccttctgacccggatgttcttgccgccataagtcaagaggaattccaaggcttcacatac
aataaccccgaatttcccccctcacccctcacagctgtctga

KEGG   Sinocyclocheilus anshuiensis: 107688094
Entry
107688094         CDS       T04917                                 

Definition
(RefSeq) protein kinase C beta type-like
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04150  mTOR signaling pathway
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04510  Focal adhesion
sanh04540  Gap junction
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107688094
   04012 ErbB signaling pathway
    107688094
   04310 Wnt signaling pathway
    107688094
   04370 VEGF signaling pathway
    107688094
   04020 Calcium signaling pathway
    107688094
   04070 Phosphatidylinositol signaling system
    107688094
   04150 mTOR signaling pathway
    107688094
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107688094
   04540 Gap junction
    107688094
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107688094
   04916 Melanogenesis
    107688094
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107688094
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107688094
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107688094
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107688094
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C CEP76-C2 C1_2
Other DBs
NCBI-GeneID: 107688094
NCBI-ProteinID: XP_016341147
LinkDB
Position
Unknown
AA seq 670 aa
MAEQSNSDGEERSAPMRGFARQGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFG
KQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKVHTYSSPTFCDHCGSL
LYGLIHQGMRCDHCMMNIHKRCVANVPSMCGTDHTERRGRIQITAEIKNNVLTVSIKEAK
NLVPMDPNGLSDPYVKLKLIPDPTSKSKQKTKTIKCCLNPTWNETFTFNLKESDKDRRLS
VEIWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKMLSQEEGEYFNVPVPPEGEEGNEEL
RQKFERAKIGPNKTDGSSSNTISKFDSNGNRDRMKLSDFNFLMVLGKGSFGKVMLSERKA
GDELFAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYI
SGGDLMYHIQQVGKFKEPHAVFYAAEIAIGLFFLHVKGIIYRDLKLDNVMLDMEGHIKIA
DFGMCKENMLDGITTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDG
EDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIREHGFFRYM
DWEKLENKEVQPPFKPKACGRDAENFDRFFTRHPPVLTPPDQEVIMNLDQDEFEAFSFIN
PEYPAMEAQS
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggcagagcaatcgaacagcgatggagaggagaggagcgcacccatgaggggctttgcc
cgacaaggtgccctgagacagaaaaacgttcacgaagttaagaaccacaagtttatcgct
cgcttcttcaagcagcctactttctgcagccactgcacggactttatctggggttttggg
aaacaaggatttcagtgtcaagtctgctgctttgtggtgcacaagcgttgccatgaattc
gtcaccttctcctgcccaggagcagataagggtcctgcatcagatgacccgcgcagtaag
cacaagttcaaggtccacacgtactccagccccaccttctgtgaccactgcggctctctg
ctgtatggactcattcaccagggcatgagatgtgaccactgcatgatgaacatccataag
cgctgtgtggccaacgtgccgagtatgtgtgggactgaccatactgagaggaggggccgc
atccaaatcaccgcagagatcaagaacaatgtgctcaccgtcagcattaaagaggcgaag
aacctggtgcccatggaccccaatggcctctctgacccctacgtcaaactaaaactcatc
cctgaccccacgagcaagagcaaacaaaagaccaagaccatcaagtgctgcctgaatccc
acgtggaacgagaccttcacatttaatctgaaggagtctgacaaggaccgcaggctgtct
gtggagatctgggactgggacttgaccagccggaacgactttatgggctctctgtctttc
ggcatctcggagcttcagaagcaaggggtggacggatggtttaagatgctcagtcaggaa
gagggcgagtacttcaatgttcctgtcccacccgaaggtgaagaaggcaatgaggaactc
cggcagaagtttgagagagctaaaattggtcccaacaaaacagacggctcttcctccaac
accatctccaaatttgacagcaatggcaaccgggaccgcatgaaactgtccgacttcaat
tttctcatggtgttgggcaagggtagctttggaaaggtgatgttgtccgagagaaaggca
ggtgatgagctgtttgcaataaagatcctgaagaaggacgtggtgatccaggatgatgac
gtagaatgcactatggtggagaagagagtgttggccttgtcaggaaaaccacccttcctc
actcaactgcactcctgctttcagacaatggaccgcctgtactttgtcatggaatacatc
agtggtggggatctcatgtatcatatccagcaggtcggcaagtttaaggaaccccatgct
gtgttctatgctgcagaaatcgccataggcctgttctttctgcatgtgaagggtattata
tacagagatctaaagttggataatgtcatgttggacatggagggtcatatcaaaatagct
gactttggcatgtgcaaggagaacatgcttgatggaatcaccaccaagaccttctgtggg
acccctgactacatcgcccctgagatcattgcttaccagccttatgggaagtcagtggac
tggtgggcttttggagttctgctctatgagatgctggctgggcagcccccatttgatggt
gaggatgaggatgagctgtttcagtccatcatggagcaccatgtgtcctatcctaaatcc
atgtccaaggaagctgtggccatctgcaaagggctgatgaccaaacacccaggcaagcgt
ctgggctgcggtcctgagggtgagcgggacatcagggaacacggctttttccgttacatg
gattgggagaagctggagaacaaggaagttcagccaccatttaaaccaaaagcttgtggc
cgggatgcagagaactttgaccgctttttcacacgccatccaccggttctcacccctcca
gaccaggaggtgatcatgaacctcgaccaagacgagtttgaggccttttccttcataaac
cccgaataccctgccatggaagcccagagttaa

KEGG   Sinocyclocheilus anshuiensis: 107689613
Entry
107689613         CDS       T04917                                 

Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04150  mTOR signaling pathway
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04510  Focal adhesion
sanh04540  Gap junction
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107689613
   04012 ErbB signaling pathway
    107689613
   04310 Wnt signaling pathway
    107689613
   04370 VEGF signaling pathway
    107689613
   04020 Calcium signaling pathway
    107689613
   04070 Phosphatidylinositol signaling system
    107689613
   04150 mTOR signaling pathway
    107689613
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107689613
   04540 Gap junction
    107689613
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107689613
   04916 Melanogenesis
    107689613
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107689613
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107689613
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107689613
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107689613
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C CEP76-C2 C1_2 Kinase-like
Other DBs
NCBI-GeneID: 107689613
NCBI-ProteinID: XP_016343151
LinkDB
Position
Unknown
AA seq 670 aa
MAEQSNSDGEEGSAPMRGFARQGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFG
KQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKVHTYSSPTFCDHCGSL
LYGLIHQGMRCDHCMMNIHKRCVANVPSLCGTDHTERRGRIQITAEIKNNVLTVSIKEAK
NLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCCLNPTWNETFTFNLKESDKDRRLS
VEIWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEEL
RQKFERAKIGPSKTDGSSSNAISKFDSNGNRDRMKLSDFNFLMVLGKGSFGKVMLAERKG
GDELFAVKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTHLHSCFQTMDRLYFVMEYI
SGGDLMYHIQQVGKFKEPHAVFYAAEIAIGLFFLHVKGIIYRDLKLDNVMLDMEGHIKIA
DFGMCKENMLDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDG
EDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIREHGFFRYM
DWEKLENKEVQPPFKPKACGRDAENFDRFFTRHPPVLTPPDQEVIMNLDQDEFEGFSFIN
PEYPAMEAQS
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggcagagcaatcgaacagcgatggagaggaggggagcgcacccatgaggggctttgcc
cgacaaggtgctctgagacagaagaacgttcacgaagttaaggaccacaagtttatcgct
cgcttcttcaagcagcctactttctgcagccactgcacggactttatctggggttttggg
aaacaaggatttcagtgtcaagtctgctgctttgtggtgcacaagcgttgccatgaattc
gtcaccttctcctgccccggagcagataagggtcctgcatcagatgacccgcgcagtaag
cacaagttcaaggtccacacgtactccagccccaccttctgtgaccactgcggctctctg
ctctatggactcatccaccagggcatgagatgtgaccactgcatgatgaacatccataag
cgctgtgtggccaatgtgccgagtctgtgtgggactgaccacactgagaggaggggccgc
atccaaatcactgcagagatcaagaacaatgtgctcaccgtcagcattaaagaggcgaag
aacctggtgcccatggaccctaatggactctctgacccctacgtcaaactaaaactcatc
cctgaccccaagagcgagagcaaacagaagaccaagaccatcaagtgctgcctgaatccc
acatggaacgagaccttcacattcaatctgaaggagtctgacaaggaccgcaggctgtct
gtggagatctgggactgggacttgaccagccggaacgactttatgggctctctgtctttc
ggcatctcggagcttcagaagcaaggggtggacggatggtttaagctgctcagtcaggaa
gagggcgagtacttcaacgtacctgtcccacctgaaggagaagaaggcaatgaggaactc
cggcagaagtttgagagagctaaaattggtcccagcaaaacagacggctcttcctccaac
gccatctccaaattcgacagcaatggcaaccgggaccgcatgaaactgtccgacttcaat
tttctcatggtgttgggcaagggtagctttggaaaggtgatgctggccgagagaaaggga
ggtgatgagctgtttgccgtaaagatcctgaagaaggacgtggtgatccaggatgatgat
gttgaatgcactatggtggagaagagagtgttggccttgtcaggaaaaccccccttcctc
actcacctgcactcctgctttcagaccatggaccgcctgtactttgtcatggaatacatc
agtggtggggatctcatgtatcatatccagcaggtcggcaagtttaaggaaccccatgct
gtgttttatgctgcagaaatcgccataggcctgtttttcctgcatgtgaagggtattata
tacagagatctaaagttggataatgtcatgttggacatggagggtcatatcaaaattgct
gactttggaatgtgcaaggagaacatgcttgatggagtcaccaccaagaccttttgtggg
acacctgactacatcgcccctgagatcatcgcttaccagccttatggaaagtcagtggac
tggtgggcttttggagttctgctctatgagatgctggctgggcagcccccatttgatggt
gaggatgaggatgagctgtttcagtccatcatggagcatcatgtgtcctatcccaaatcc
atgtccaaagaagctgtggccatctgcaaagggctgatgaccaaacacccaggcaagcgt
ctgggctgcggtcctgagggtgagcgggacatcagggaacacggctttttccgttacatg
gattgggaaaagttggagaacaaggaagttcagccaccgtttaaaccaaaagcctgtggc
cgggatgcagagaactttgaccgctttttcacccgccatccaccggttctcacccctcca
gaccaggaggtcatcatgaacctcgaccaagacgagttcgagggcttttccttcataaac
cccgaataccctgccatggaagcccagagttaa

KEGG   Sinocyclocheilus anshuiensis: 107692563
Entry
107692563         CDS       T04917                                 

Definition
(RefSeq) protein kinase C alpha type-like isoform X1
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04150  mTOR signaling pathway
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04510  Focal adhesion
sanh04540  Gap junction
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107692563
   04012 ErbB signaling pathway
    107692563
   04310 Wnt signaling pathway
    107692563
   04370 VEGF signaling pathway
    107692563
   04020 Calcium signaling pathway
    107692563
   04070 Phosphatidylinositol signaling system
    107692563
   04150 mTOR signaling pathway
    107692563
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107692563
   04540 Gap junction
    107692563
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107692563
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107692563
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107692563
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107692563
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107692563
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like APH NT-C2
Other DBs
NCBI-GeneID: 107692563
NCBI-ProteinID: XP_016347141
LinkDB
Position
Unknown
AA seq 695 aa
MSTPVSPSPSLSPLALSSPSPSSSLLPSPLSPPPRLPVFQRKGALKHKRVIEVKDHQFTA
RFFKQPTFCSHCTDFIWGIGKQGFQCQVCSFVVHKRCHEFVTFTCPGAITTPKAEDLKSK
HKFKVHTYSSPTFCDHCGSLLYGLIHQGMKCASCDMNVHKRCENSVPSLCGQDHTEKRGR
IRLTVRGEKEDIYVTVHEAHNLMPMDPNGLSDPYVKLKLIPDPKSQSKQKTKTIRSTLNP
IWNESFTFSVRGRQWDRRLSVEVWDWDRTSRNDFMGALSFGVSEIFRRSVSGWFKLLNQD
EGEYYNIPVPDPDLQVPDAALTPSVPPAPVTVTTPVPTVTPPALSPTPTALHTGKGQVRL
HDFNFLMVLGKGSFGKVLLAEERGSERLFAVKVLKKDVLFQDEDTESAMVERRVLGLVGR
PHFLTSLYCAFQTEDRLYYVMEYVNGGDLMFHIQIVGKFKEPHAAFYAAEIAVGLFFLHN
KGIIYRDLKLDNVLLDSKGHIKIADFGMCREGMMEGDTTRTFCGTPDYIAPEIVAYQPYG
KAVDWWSYGVLLYEMLAGQPPFDGIDEEELFQSIMEQSVSYPKSLSREAVAICKGLLTKN
PAKRLGGGEDAERELREHPFFRWIDWDRLERLETQPPFKPRSGGRKGENFDNFFTSAPSA
LTPSDPDVLAAISQEEFQDFTYINPEFPPSPLTAV
NT seq 2088 nt   +upstreamnt  +downstreamnt
atgtctaccccggtctctccgtctccatctctgtctcccctggccctgtcctcaccatct
ccctcctcctccctgctcccctctcctctttctcctccccccaggctgccagtcttccag
aggaagggagctctcaagcacaagagggtcattgaagtgaaggaccaccagttcacagcc
cgattcttcaagcagcctactttctgcagccactgcactgacttcatctggggaattgga
aagcaaggattccagtgtcaagtctgcagttttgtggtgcacaaacgctgccatgagttt
gtcacttttacttgtcccggagccatcactactcccaaagcagaggatctcaagagcaaa
cacaagtttaaagtacatacatactccagtccaaccttctgtgatcactgtgggtctctg
ctgtacggcctcatacatcagggcatgaaatgtgccagttgtgacatgaatgtacacaag
cgctgtgagaacagcgtccccagcctgtgcggacaggaccacactgagaaaagaggacgg
attcgcctgaccgtgcgtggagagaaagaggacatatatgtcacagtgcatgaagcccat
aacctgatgcccatggatcctaatggcctgtcggacccttatgtgaagctcaaactcata
cctgatccaaaaagccagagcaaacagaaaaccaaaaccatccgttctacactcaaccct
atctggaatgagagcttcactttttcagtgcgcgggaggcagtgggacaggcgtttgtct
gtagaggtctgggactgggatcggacctcacggaatgacttcatgggcgctttgtcattc
ggcgttagtgagatattcagacgttcagtcagcggctggttcaaactactcaaccaggat
gagggagagtattataacatccctgtacctgacccagacctgcaggtaccagatgctgct
ctcacgccctctgttcctcctgctcctgttactgtgacgacgcctgttcctactgtgacc
cctcctgctctgagtccgactcccactgcactgcacacgggcaaaggccaagtcaggctg
cacgatttcaacttcctcatggttctgggcaaagggagctttggcaaggtcctgctggca
gaggagaggggcagcgagcgcttgtttgcggtgaaggtgttgaagaaggacgtgctgttt
caggatgaggacacagagagcgctatggtggagagaagagtgctgggcctcgtggggcga
cctcacttcctgacctccctctactgcgcctttcaaaccgaggatcgtctgtattacgtc
atggagtacgtgaacggtggtgatcttatgtttcacatccaaatcgtcggcaagtttaaa
gaaccgcatgcagcgttctatgctgctgagatcgcggtgggtctgttcttcctgcacaac
aaaggcatcatatacagagatctaaagctggacaatgtcctgctggacagtaaaggacac
ataaagatagcagactttgggatgtgtagggaaggcatgatggaaggggacaccactcgc
accttctgtggcacacctgattacatcgcacctgagattgtggcgtatcagccgtatggt
aaagcagtggactggtggtcgtatggagtcctgctctatgagatgctggctgggcagcct
ccttttgatggtatagatgaggaggagctgtttcagtccatcatggaacagagcgtttca
tatccgaagagtctctctcgggaggctgtggccatctgcaaagggctcctcaccaagaac
cctgctaagcgtttgggtggaggagaggatgcagagagagagctgcgggagcatcctttt
ttccgctggatagactgggaccgactggagagactggagacacagcctcccttcaaaccc
agaagtggaggcagaaaaggagagaactttgataattttttcacatccgccccctccgcc
ctcacgccttctgacccggatgttctcgccgctataagtcaagaggaattccaagacttc
acctacataaacccggaatttcctccctcacccctaacagctgtctga

KEGG   Sinocyclocheilus anshuiensis: 107692661
Entry
107692661         CDS       T04917                                 

Gene name
prkcb
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04150  mTOR signaling pathway
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04510  Focal adhesion
sanh04540  Gap junction
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107692661 (prkcb)
   04012 ErbB signaling pathway
    107692661 (prkcb)
   04310 Wnt signaling pathway
    107692661 (prkcb)
   04370 VEGF signaling pathway
    107692661 (prkcb)
   04020 Calcium signaling pathway
    107692661 (prkcb)
   04070 Phosphatidylinositol signaling system
    107692661 (prkcb)
   04150 mTOR signaling pathway
    107692661 (prkcb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107692661 (prkcb)
   04540 Gap junction
    107692661 (prkcb)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107692661 (prkcb)
   04916 Melanogenesis
    107692661 (prkcb)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107692661 (prkcb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107692661 (prkcb)
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107692661 (prkcb)
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107692661 (prkcb)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like zf-RING_9 APH CBX7_C RIO1 CEP76-C2
Other DBs
NCBI-GeneID: 107692661
NCBI-ProteinID: XP_016347312
UniProt: A0A671LQS5
LinkDB
Position
Unknown
AA seq 668 aa
MADPAAAEGAGGARGFARQGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFGKQG
FQCQVCGFVVHKRCHEFVTFSCPGADKGPASDDPRSKHRFKVHTYSSPTFCDHCGSLLYG
LIHQGMKCDTCMMNIHKRCVENVPSLCGTDHTERRGRLHISASITNNVLTVTVKEARNLV
PMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPTWDEHFSFNLRDTDKDRRLSVEV
WDWDLTSRNDFMGSMSFGISELQKQGVDEWFKLLGQEEGEYFNVPVPPDGEEGNEELRQK
FERAKIGPGTKNTDGSSKNDISKYDTNGNQDRMKLSDFNFIMVLGKGSFGKVMLAERKGS
DELYAVKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYIN
GGDLMYQIQQVGKFKEPHAVFYAAEIAIGLFFLQSKGIVYRDLKLDNVMLDAEGHIKIAD
FGMCKENMFDGATTKTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGE
DEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYMD
WEKLQNMEVQPPFKPKACGRDAENFDRFFTRHPPVLTPPDQEVIQNLDQEEFQGFSYINP
NFASVKSK
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggccgacccagcggctgcggagggcgcggggggcgcgcgaggcttcgccaggcagggc
gcgctgaggcagaagaacgtgcacgaagtgaagaaccacaagttcatcgcgcgcttcttc
aaacaaccgaccttctgcagccactgcaccgacttcatctggggtttcggcaagcaaggc
ttccagtgtcaagtgtgtggtttcgtggtccacaaacgctgccatgagtttgttacattc
tcctgccccggggccgacaagggccccgcatcagatgaccctcgaagtaagcataggttc
aaggtacacacatactccagccccacattctgtgaccactgtggttctctactgtacggg
ctcatacaccaggggatgaaatgcgacacttgtatgatgaatattcataaacgatgcgtg
gagaatgttcccagcctgtgtggaacagaccacacagagaggagaggacggctgcatatc
agtgctagtatcacaaataatgttctcacagtgactgtcaaggaagctcgtaacttggtg
ccaatggatccaaacggcctgtcagatccatacgtgaagcttaaattaattccagaccca
aagagcgagagcaagcagaagaccaaaaccatcaagtgctccctcaatcctacctgggac
gaacacttcagctttaacctcagagatacagataaagacaggcgtttgtcagtggaggtg
tgggattgggatctgaccagcagaaatgacttcatggggtcgatgtcttttggcatctct
gagctgcagaaacaaggtgtcgacgaatggtttaagttgctgggccaagaggaaggggag
tatttcaacgttccagttccaccagacggcgaggagggcaatgaagaactgcggcagaaa
tttgagagagccaagattggccctggcactaagaatacagatggctcttcaaagaatgac
atctccaaatacgataccaatggcaaccaagaccgcatgaagctctcagacttcaacttc
atcatggtgctgggcaaaggcagctttggcaaggtgatgctcgccgagcgtaaaggctca
gatgagctgtatgcagtgaagatcttgaagaaggatgtggtcattcaggatgatgatgtg
gaatgcactatggtggagaagagagttctcgctctctctggcaaaccacccttcctcacc
cagctccactcgtgctttcagaccatggaccgtctttactttgtgatggagtatatcaac
ggtggagatttgatgtatcaaatacaacaagtgggaaaatttaaggaaccccatgctgtg
ttctatgctgcagaaattgccatcggcttgttctttcttcaatcaaagggcattgtttac
agagatctgaagctggataatgtgatgttggatgctgaaggccacattaaaattgcagat
tttggcatgtgcaaagagaacatgtttgatggggccacaaccaaaaccttctgtggcact
ccagactacattgccccagagatcattgcatatcagccgtatggcaagtctgttgactgg
tgggcttatggagttctcctctatgaaatgctggcaggacagcccccttttgatggtgag
gatgaagatgagcttttccagtcaatcatggagcatcatgtgtcttaccccaaatccatg
tccaaagaagcagtggccatatgcaaagggctgatgaccaagcatccagggaagcgtctg
ggctgtggaccggagggagagcgagacattaaggaacacgctttcttccgctacatggac
tgggaaaaactgcaaaatatggaagttcaacctcccttcaagcccaaggcatgcggtcga
gacgcagagaactttgatcgttttttcacccgtcatcctcccgtcctgacccctcctgac
caggaagtgattcaaaacttggaccaagaagaatttcagggcttctcgtacattaatcca
aattttgcatctgtgaaatccaagtag

KEGG   Sinocyclocheilus anshuiensis: 107694902
Entry
107694902         CDS       T04917                                 

Definition
(RefSeq) protein kinase C alpha type-like
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04150  mTOR signaling pathway
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04510  Focal adhesion
sanh04540  Gap junction
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107694902
   04012 ErbB signaling pathway
    107694902
   04310 Wnt signaling pathway
    107694902
   04370 VEGF signaling pathway
    107694902
   04020 Calcium signaling pathway
    107694902
   04070 Phosphatidylinositol signaling system
    107694902
   04150 mTOR signaling pathway
    107694902
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107694902
   04540 Gap junction
    107694902
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107694902
   04916 Melanogenesis
    107694902
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107694902
   04270 Vascular smooth muscle contraction
    107694902
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107694902
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107694902
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107694902
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107694902
Membrane trafficking [BR:sanh04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    107694902
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like
Other DBs
NCBI-GeneID: 107694902
NCBI-ProteinID: XP_016350102
LinkDB
Position
Unknown
AA seq 656 aa
MADIIQSNEQSSSDVANRFARKGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFG
KQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSL
LYGLIHQGMKCDSCDTNVHKQCVMNVPSLCGMDHTERRGRLYLKIEVIEEKMHVTVGEGK
NMIPMDPNGLSDPYVKLKLIPDPKNETKQKTKTIRSSLNPAWNESFTFVEAAKLKALPYY
MMGRVLVSELMKSSVCGWYKVLNQEEGEYYNVPIPDDDDENTELRQKFEKAKLGPSKRAT
TPLDDSGSTLPSSSMDRVKLTDFNFLAVLGKGSFGKVMLAEMKSTGELFAIKILKKDVVI
QDDDVECTMVEKRVLAQQDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFK
EPQAVFYAAEIAVGLFFLHKKGVIYRDLKLDNVMLDAEGHIKIADFGMCKENIVEGVTTR
TFCGTPDYIAPEIIAYQPYGRSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVS
YPKSMSKEAVSICKGLMTKHSSKRLGCSPEGERDIREHAFFRRIDWERLENREIQPPFKP
KVCGKGAENFDKFFTRTQPQLTPPDELVIANIDQAEFDGFSFINLQFIHPSIINSE
NT seq 1971 nt   +upstreamnt  +downstreamnt
atggctgatatcatacaaagcaacgagcagtcctcatctgacgttgcaaatcgattcgcc
cgtaaaggtgctttgaggcagaaaaacgtccatgaagtgaaaaaccacaaatttattgcg
aggtttttcaagcagccgactttctgcagtcactgcactgactttatttgggggtttggg
aagcaaggatttcagtgccaagtgtgctgctttgtggtccataaacgttgccatgaattt
gtcacattctcatgccctggagctgataaagggccagacacagatgaccctaggagcaag
cacaaatttaagatccacacctatggcagtcccacattctgtgaccactgtggatctctt
ctatatggactcatacaccaaggaatgaaatgtgactcctgtgatacgaatgtccataag
cagtgtgtgatgaacgtgccaagcctttgtggaatggaccacacagagagacgaggacgt
ctttacttgaagatcgaggtgatagaagaaaaaatgcatgtcacagtgggggaaggcaag
aacatgattccaatggacccgaatggattgtctgatccatatgtaaaactcaagttgatt
ccagaccctaaaaatgagacaaaacagaaaacgaaaactatccgttcttccctgaatccg
gcttggaacgagtcatttacatttgtggaagcagccaaactgaaagccctgccttattat
atgatggggagagtgctagtgtctgagctcatgaaatcctcagtgtgtggatggtataaa
gtgttaaaccaggaggagggggagtactacaatgtgcccattccagatgatgatgatgag
aatactgagctccgacagaagtttgagaaagccaaattgggtccatccaaaagagccacc
acccctttggatgatagtgggtccactttaccctcaagcagtatggacagagtcaaactc
acagactttaatttcttggcagtgttgggaaaaggcagttttggaaaggtgatgctggct
gagatgaagtctactggtgaactatttgctataaagatccttaagaaggatgtggtcatc
caggatgatgatgttgaatgcaccatggtggagaagcgggttctggctcagcaggacaaa
ccgccattcctcacccagcttcactcctgctttcagactgtggatcgtctgtatttcgtg
atggagtatgttaatggtggtgatctgatgtaccacatccagcaagtgggcaaatttaag
gagccacaagcagtgttctacgctgcagagattgctgttggactttttttcttgcacaag
aaaggagtcatatacagggatctgaaattagataatgtcatgctggatgcagagggtcat
attaagattgcagacttcggtatgtgcaaggagaacattgtggagggtgtgaccacccgt
acattttgtggaacaccagactacatcgctccagagataatagcatatcagccgtatggc
cgttctgtggactggtgggcttatggagtgctgctgtacgagatgctggcgggacagcct
ccgtttgatggtgaggatgaagacgaactttttcagtccattatggagcacaatgtctcc
taccctaaatccatgtccaaagaagcagtttccatctgcaaagggctgatgacaaaacac
tcttcaaagcgtctgggctgcagcccagagggggaaagagatattagggaacatgctttc
ttccgtcggattgactgggaacgcctggaaaacagagaaatacagcctccattcaaaccc
aaagtgtgtggaaagggggcagagaactttgacaagttcttcacacgcacacagccacaa
ctgacccctcctgatgagctggttatcgccaacatcgaccaggctgaatttgatggattt
tccttcatcaaccttcaattcatccatccctccatcatcaacagtgaataa

KEGG   Sinocyclocheilus anshuiensis: 107698783
Entry
107698783         CDS       T04917                                 

Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04150  mTOR signaling pathway
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04510  Focal adhesion
sanh04540  Gap junction
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107698783
   04012 ErbB signaling pathway
    107698783
   04310 Wnt signaling pathway
    107698783
   04370 VEGF signaling pathway
    107698783
   04020 Calcium signaling pathway
    107698783
   04070 Phosphatidylinositol signaling system
    107698783
   04150 mTOR signaling pathway
    107698783
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107698783
   04540 Gap junction
    107698783
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107698783
   04916 Melanogenesis
    107698783
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107698783
   04270 Vascular smooth muscle contraction
    107698783
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107698783
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sanh04131]
    107698783
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107698783
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107698783
Membrane trafficking [BR:sanh04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    107698783
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 107698783
NCBI-ProteinID: XP_016355376
LinkDB
Position
Unknown
AA seq 681 aa
MADHLIQINDSSAAVNRFARKGAQRKKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFGK
QGFQCQVCCFVVHKRCHEFVSFSCPGADKGPDTDDPRSKHKFKIHSYGSPTFCDHCGSLL
YGLIHQGMKCDTCDMNVHKQCVMNVPSLCGTDHTERRGRLFLKIEVSGDRLHVTVCEARN
LIPMDPNGLSDPYVKLKLIPDPKNETKQKTRTIRSSLNPTWNESFIFKLKPSDKERRLSV
EVWDWDRTTRNDFMGSMSFGVSELIKAPLCGWYKMLNQEEGEYYNVPIPEESDINLELRQ
KFEACQFNIHLLKKARLGPGKKVITPSDHRRFSLPSGNMNRVQLNDFHFLALLGKGSFGK
VMLAERKSTEELYAIKILKKDVVIQDDDVECTMVEKRVLAQRDKPPFLTQLHSCFQTVDR
LYFVMEYINGGDLMYHIQQVGKFKEPQAVFYAAEIAVGLFFLHRKGIIYRDLKLDNVMLD
SEGHIKIADFGMCKEHMYEGMTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEML
AGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPSKRLGCGPEAERDIK
EQAFFRRIDWERLANREIQPPFKPKVCGKAAENFDKFFTRTQPMLTPPDQLVIANIDQSE
FAGFSYINPEFIHPSSLHSVV
NT seq 2046 nt   +upstreamnt  +downstreamnt
atggctgatcatctgatacagatcaatgactcgtccgccgcggtcaatcgattcgcgcgg
aaaggagctcagcgaaagaagaacgtgcacgaagttaaaaaccacaaatttatcgctcga
ttcttcaagcagcccacattctgcagccactgcaccgactttatctggggatttggaaag
caaggcttccagtgccaagtgtgctgttttgtggtccacaaaaggtgccatgagtttgtt
tcattctcctgtccaggggccgacaagggccctgacacagatgatcccagaagcaagcac
aagttcaagatccacagctacggcagtcccacattctgcgaccactgcggatcgctgctg
tacggcctcatccaccaggggatgaaatgcgacacctgtgacatgaacgttcataagcag
tgtgtgatgaacgtgccaagtctgtgcgggaccgaccacactgaacgcagaggaagactc
ttcctcaagatcgaggtcagcggagacagacttcacgtcacagtgtgtgaggcccgaaat
ctgattcccatggaccccaatggtctatcagacccgtatgtgaagctcaaactcatccca
gaccccaagaatgagaccaaacagaagacccgcaccatccgctcctcgctcaaccccacc
tggaacgagtccttcatctttaagttaaagccatcggataaggagcgccgtctgtccgtg
gaggtgtgggattgggacagaaccacccgtaatgacttcatgggctccatgtcctttggt
gtgtctgagctgatcaaagctcctctatgtggctggtataagatgttaaaccaggaggag
ggtgagtactacaacgtgcccatcccagaggagagcgacattaacctggagctgcggcag
aagtttgaggcctgtcagttcaatatccacctgctgaagaaagccaggctcggtcctggg
aagaaagtcatcactccctctgatcaccgacgcttcagtttaccatctggaaacatgaac
agagttcaactcaatgacttccattttctggctcttctgggcaaaggcagttttgggaag
gtaatgttggcagagaggaagtccactgaggagctgtacgccattaaaatcctgaagaag
gacgtggtgatccaggatgatgatgtggagtgcacaatggtggagaagagagtgctggcc
cagagagataagccacctttcctcacccagctgcactcctgcttccagactgtggatcgt
ctgtactttgtaatggagtacattaacggaggagacctgatgtatcacatccagcaagtg
ggcaagtttaaggagccacaagccgtattctatgcagcagagattgctgtcggactcttc
tttcttcataggaagggaattatttacagagatctgaagttggataatgtgatgttggac
tccgagggccacatcaagattgcagacttcggcatgtgtaaggaacacatgtatgagggc
atgacgacacgcaccttctgtggaacgccggattacatcgccccggagataatcgcctat
cagccgtacgggaaatcagtggactggtgggcgtacggtgtgctcctctacgagatgctg
gctgggcagcctccatttgatggcgaggatgaggatgagctctttcagtccataatggag
cacaatgtgtcttaccccaaatccctgtctaaagaggcagtgtccatctgtaaagggctg
atgacgaagcatccatccaagcgtctaggttgcggtccagaggctgagcgagatataaag
gagcaagctttcttccgcagaatcgactgggaacggttggccaacagagagatccagcct
cctttcaaacccaaagtgtgcggcaaagcggcggagaacttcgacaaattcttcacccgc
acacagcccatgctgacccctccagaccaactggtcatcgccaacatcgaccagagcgaa
ttcgctggattctcttacataaacccagagttcatccacccatcgtcgcttcacagtgtg
gtatga

KEGG   Sinocyclocheilus anshuiensis: 107702530
Entry
107702530         CDS       T04917                                 

Definition
(RefSeq) protein kinase C beta type-like
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04020  Calcium signaling pathway
sanh04070  Phosphatidylinositol signaling system
sanh04150  mTOR signaling pathway
sanh04270  Vascular smooth muscle contraction
sanh04310  Wnt signaling pathway
sanh04370  VEGF signaling pathway
sanh04510  Focal adhesion
sanh04540  Gap junction
sanh04912  GnRH signaling pathway
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107702530
   04012 ErbB signaling pathway
    107702530
   04310 Wnt signaling pathway
    107702530
   04370 VEGF signaling pathway
    107702530
   04020 Calcium signaling pathway
    107702530
   04070 Phosphatidylinositol signaling system
    107702530
   04150 mTOR signaling pathway
    107702530
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107702530
   04540 Gap junction
    107702530
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107702530
   04916 Melanogenesis
    107702530
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107702530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107702530
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107702530
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107702530
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 CBX7_C zf-RING_9 Kinase-like APH
Other DBs
NCBI-GeneID: 107702530
NCBI-ProteinID: XP_016360365
LinkDB
Position
Unknown
AA seq 668 aa
MADPVAAGGAGGARGFARQGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFGKQG
FQCQVCGFVVHKRCHEFVAFSCPGADKGPASDDPRSKHKFKVHTYSSPTFCDHCGSLLYG
LIHQGMKCDTCMMNIHKRCVENVPSLCGTDHTERRGRLHISASITTNVLTVTVKEARNLV
PMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPTWDEHFSFNLRDTDKDRRLSVEV
WDWDLTSRNDFMGSMSFGISELQKQGVSGWFKLLGQEEGEYFSVPVPPDGEKGNEELRQK
FERAKIGPGNKNTDGSSKNDISKYDANGNKDRMKLSDFNFIMVLGKGSFGKVMLAERKGS
DELYAVKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTHLHSCFQTMDRLYFVMEYIN
GGDLMYQIQQVGKFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDAEGHIKIAD
FGMCKENMFDGATTKTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGE
DEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYMD
WEKLQSKEVQPPFKPKACGRDAENFDRFFTRHPPVLTPPDQEVIQNLDQEEFQGFSFNNP
NFVSVKSK
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggccgacccagtggctgcggggggcgcggggggcgcacgaggcttcgccaggcagggc
gcgctgaggcagaagaacgtacacgaagtgaagaatcacaagttcatcgcgcgcttcttc
aagcagccgaccttctgcagccactgcaccgacttcatctggggtttcggcaagcaaggc
ttccagtgtcaagtatgcggttttgtggtccacaaacgctgccatgagtttgttgctttc
tcctgccctggagccgacaagggcccagcatcagatgaccctcgcagtaagcataagttc
aaggtacacacatactccagccctaccttctgtgaccactgtggatctctactgtacggg
ctcatacaccaggggatgaaatgcgacacttgtatgatgaatattcataaacgatgcgtg
gaaaatgttcccagcttgtgtggaacagaccacaccgagaggagaggacggctgcatatc
agtgctagtatcacaactaatgttctcaccgtgacagtcaaggaggctcgtaacttggtg
ccaatggatccaaacggtctgtcagatccatatgtgaagcttaaattaattccagaccca
aagagcgagagcaagcagaagacaaaaaccatcaagtgctccctcaatcctacatgggac
gaacacttcagctttaacctcagagatacagataaagacaggcgtttgtcagtggaggtg
tgggattgggatctgaccagcagaaatgacttcatggggtcgatgtcttttggcatctct
gagctgcagaaacaaggtgtcagtggatggtttaagttgctgggccaagaggaaggggag
tatttcagcgttccagttccaccagatggagagaagggcaatgaagaactgcggcagaaa
tttgagagagccaagattggccctggcaataagaatacagatggctcttcaaagaatgac
atctctaaatacgatgccaatggcaacaaagaccgcatgaaactctcagacttcaacttc
atcatggtgctgggcaaaggcagctttggcaaggtgatgcttgctgaacgtaaaggctca
gatgagctgtacgcagtgaagatcttgaagaaggatgtggtcattcaggatgatgatgtg
gaatgcactatggtggagaagagagttctcgctctctctggcaaaccgcccttcctcacc
cacctccactcgtgctttcagaccatggatcgtctttactttgtgatggagtatatcaac
ggtggagatttgatgtatcaaatacaacaagttggaaaatttaaggaaccccatgctgtg
ttctatgctgcagaaattgccatcggcttgttctttcttcaatcaaagggcattatttac
agagatctgaaactggataatgtgatgttggatgctgaaggccacattaagattgcagat
tttggcatgtgcaaagagaacatgtttgatggggccacaaccaaaaccttctgtggcact
ccagactacattgccccagagatcattgcatatcaaccgtatggcaagtctgtcgactgg
tgggcgtatggagttttactgtatgaaatgctggcaggacagcccccttttgatggtgag
gatgaagatgagcttttccagtccatcatggagcatcatgtgtcttacccgaaatccatg
tccaaagaagcagtggccatatgcaaggggctgatgaccaagcatccagggaagcgcctg
ggctgtggaccagaaggagaacgagacattaaggaacacgctttcttccgctacatggac
tgggaaaaactgcaaagcaaggaagttcaaccccccttcaaacccaaagcatgcggtcga
gacgcagagaactttgatcgttttttcacccgccatcctcccgtcctgacccctcctgac
caggaagtgattcaaaacttggaccaagaagaatttcagggcttctcattcaataatcca
aattttgtatctgtgaaatccaagtag

DBGET integrated database retrieval system