KEGG   Sinocyclocheilus anshuiensis: 107673622
Entry
107673622         CDS       T04917                                 

Definition
(RefSeq) protransforming growth factor alpha-like isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107673622
   04012 ErbB signaling pathway
    107673622
SSDB
Motif
Pfam: Mucin SSP160 PepSY_TM EGF Laminin_EGF DUF4834 FSA_C DUF3439
Other DBs
NCBI-GeneID: 107673622
NCBI-ProteinID: XP_016322775
LinkDB
Position
Unknown
AA seq 212 aa
MLLFRCFLIAIMVMSLAIFDFVGSSFSHLGSLFTYGQVQENSNSTTTIATTTTTTTTTTT
SSTTTTTTTTRVKKFIVAAVHSHFDDCPDSHSHFCFHGTCRFLILEETPACVCHPGFVGM
RCEHADLLAVVASNHRQQTVATMLVLCVVGSVLLMLLCTLLNCWWRRGGCGRGNTISCWS
EKPRSILTGGTSCCHSETGILVLHFHFYTAFC
NT seq 639 nt   +upstreamnt  +downstreamnt
atgctgttgttccgctgttttctcattgctataatggtcatgagtctggcaatttttgac
tttgttggatcctcattttcacatttgggctccctttttacatatgggcaggtgcaagag
aattctaactcaacaacgaccattgcaaccaccacaacaacaactaccacaacaaccacc
tccagcacgacgacaaccactactaccacacgtgtcaaaaaatttatagtagccgctgtc
cactctcacttcgatgactgcccggactcccacagccacttctgttttcatggcacatgc
cgctttctcatactggaggaaacacctgcatgcgtatgtcatcctggctttgtaggtatg
cgatgcgaacatgcagatctcttggctgtggtggcgtctaaccacaggcagcagaccgtg
gccaccatgctggtgttgtgtgtagtgggcagtgttctactcatgctgctctgcacttta
ctaaattgttggtggagacggggtggttgtgggcgaggtaacaccatttcgtgttggtcg
gagaagcctaggagtattttgacgggtgggacatcctgctgtcactcagaaacaggtatt
ctggtgctacatttccatttttacacagctttttgctga

DBGET integrated database retrieval system