KEGG   Sinocyclocheilus anshuiensis: 107673748
Entry
107673748         CDS       T04917                                 

Definition
(RefSeq) TGF-beta receptor type-2-like isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04060  Cytokine-cytokine receptor interaction
sanh04068  FoxO signaling pathway
sanh04144  Endocytosis
sanh04218  Cellular senescence
sanh04350  TGF-beta signaling pathway
sanh04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107673748
   04350 TGF-beta signaling pathway
    107673748
   04068 FoxO signaling pathway
    107673748
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107673748
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107673748
  09143 Cell growth and death
   04218 Cellular senescence
    107673748
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107673748
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107673748
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107673748
Protein kinases [BR:sanh01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   107673748
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 107673748
NCBI-ProteinID: XP_016323000
LinkDB
Position
Unknown
AA seq 602 aa
MGRGGCSLWAQTSVLLCFCPVLIAVLQAQSFTLIKTNLCKWCDHSSPVCEDNVCMSNCSL
TSYCTLAEEVCVAIWKKDNVSVSVRTLCYNPQDMLENIMLANYSSKECLMAPQHSEDGLL
FICGCIGDHECNDRLIFDKGVNGFSKLKSKDVIPVVVISLVPPLLVAVIATMAFYLYRTR
QPGKKPKDWGPRRTHYQSLDPAEGQVNGSNYRGKLPSLSDGVNSEISSTCANNLNHNTEQ
LPIQLEALVGKGRFAEVWRARLSHNEGGQYETVAVKIFPAVEYSSWCNERAIFSDANLKH
ENIVQFLTAEERGGTAAAPQRQYWLIMAYYNMGNLQDFLTGHIFTWTELCSLAGSVARGL
AHLHSDTTPCGTPKVPIAHRDLKSSNIVLKNHSECALCDFGLALQLDLSLTVDDFANSGQ
VGTARYMAPEVLESRVNLEDLESFKQIDIYSMALVLWEMVSRCDVIGEVKSYEPPFSSKV
CEQPCIDSMRDLVLRDRGRPDIPASWTAHPGMQLVCATITECWDHDPEARLTAHCVVERF
NTLAQEELENSICTHTPILPSTEDQSPSLPSLPPCTDHSTGIHPHFTSDTQISVSSRQPS
QM
NT seq 1809 nt   +upstreamnt  +downstreamnt
atggggcgtggaggctgcagtttgtgggctcaaacatctgttcttctgtgtttctgtcct
gtccttattgcagtgttgcaggcgcagagcttcaccctcataaagaccaacctctgtaag
tggtgtgaccactcaagtcctgtatgtgaagacaacgtctgcatgagcaactgcagtctg
acctcttactgtactctggctgaagaagtgtgcgtagcgatatggaagaaggacaatgtg
agcgtgagtgtgcggacactgtgttataaccctcaggatatgctggagaacataatgctg
gcaaactactcctccaaagagtgtttgatggcacctcagcactctgaagatggcctgctc
ttcatctgtggctgtatcggagatcatgagtgcaacgacagactcatcttcgacaaagga
gtcaatggattctcaaagctgaagtctaaagatgtcattccagtagtagtcataagcctg
gttccacccctcctggtagctgtcattgctaccatggctttttacctgtaccgcacacgt
cagcctggcaaaaaaccgaaagactgggggccacgacgcacccactaccagtctctagat
ccagccgagggccaagtaaatggtagcaattaccgcggcaagctgccgtccctcagcgat
ggcgtcaattcagaaatctcatcgacttgtgccaataacctaaaccacaacacagagcag
ctgcccatccagctggaggcgctggtggggaaggggcgcttcgcagaggtatggcgggca
cggctcagtcataatgagggtgggcagtatgaaacggtggccgtgaagatcttcccggcg
gtggagtattcctcatggtgtaacgaaagggccatattctctgacgccaacttaaaacat
gagaatatagtgcagttcctgactgctgaggagcgaggcggtactgctgctgccccccag
aggcaatactggctcatcatggcttattataacatgggcaaccttcaggactttctgact
ggtcatatcttcacatggactgagctgtgttcactggcaggctctgtggcgagaggcctg
gcgcacctgcacagtgacacaacaccctgcggcacaccaaaagtacccatcgcccacaga
gatctgaagagcagcaacattgtattgaagaaccacagcgagtgtgcgctctgtgatttc
ggactggctctacaactcgacctctcgctcaccgtagatgactttgccaacagtggacag
gtagggacagcacgctacatggccccagaagttctggagtccagggtaaatctagaggac
ttagagtcctttaaacagattgatatctactccatggccctggtgctgtgggaaatggtc
tctaggtgtgacgtcataggagaggtaaagagttatgaacccccatttagctcaaaggtg
tgtgaacaaccttgtatagacagcatgagagatctggtgttaagagacagaggacgacca
gatattccagcgagctggacagcacatccaggcatgcagctcgtgtgtgcgactataaca
gagtgctgggatcacgacccagaggctcgtctgacagcacactgcgtggtggaacgcttc
aatactctggcacaggaagagctggagaactccatctgcacccacacacccatattgcca
tctacagaggaccaaagcccatcccttccatcccttcctccctgcacggaccacagcact
ggcatccatccgcattttacatctgacacgcagatctctgtttcctccaggcaaccgagt
caaatgtga

DBGET integrated database retrieval system