KEGG   Sinocyclocheilus anshuiensis: 107675968
Entry
107675968         CDS       T04917                                 

Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase-like isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04270  Vascular smooth muscle contraction
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04540  Gap junction
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107675968
   04012 ErbB signaling pathway
    107675968
   04370 VEGF signaling pathway
    107675968
   04371 Apelin signaling pathway
    107675968
   04068 FoxO signaling pathway
    107675968
   04150 mTOR signaling pathway
    107675968
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107675968
  09143 Cell growth and death
   04210 Apoptosis
    107675968
   04218 Cellular senescence
    107675968
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107675968
   04540 Gap junction
    107675968
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107675968
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107675968
  09152 Endocrine system
   04910 Insulin signaling pathway
    107675968
   04912 GnRH signaling pathway
    107675968
   04914 Progesterone-mediated oocyte maturation
    107675968
   04916 Melanogenesis
    107675968
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107675968
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107675968
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107675968
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107675968
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   107675968
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 zf-RING-like Kinase-like C1_2
Other DBs
NCBI-GeneID: 107675968
NCBI-ProteinID: XP_016325953
UniProt: A0A671LB11
LinkDB
Position
Unknown
AA seq 642 aa
MEHLQGSWKNISHGFGCKDSVFEDSCMSPTILKNFPYRRLSDGRIPDPKTSSTIRVYLPN
KQRTVVNVRAGMTLRNCLIKALKVRGLQPECCAVFKLHREHSFKKLHMDWSTDSSSLVGE
ELLVEVLDHVPLTTHNFVQKTFLKLAFCDICQKFLLHGFRCQTCGYKFHEHCSTKVPTMC
VDWSNIRQLLLFPTPGENGTPSLPPRSSRRMHNSKFSFSPYHRYSTPNALSYISPMPCAG
VSLSRKVLSTSTPNVHMVSTLHETAAFQEALGRDESGSPTDCSRTPAPAHREKAPSNNTQ
EKRLRPREKRDSSYYWEIEATEVLLLSRIGSGSFGTVYKGKWHGDVAVKILKVTNPTPEQ
LQAFRNEVAVLRKTRHVNIVLFMGYMTRANLAIVTQWCEGSSLYKHLHVQETSFQMLQLM
DIARQTAQGMDYLHAKNIIHRDMKSNSIFDVFLHCTGEEVKHRCHRSSDIVLHEGLTVKI
GDFGLATVKARWSGSHRVEQPSGSVLWMAPEVIRMQDSNPHSFQSDVYSYGIVLYELMTG
ELPYSGIGNRDQIIFMVGRGYLTPDLSKLYKSCPKAMKRLVADCMQKSRDDRPLFPQVLS
SIELLQHSLPKINRSASEPSLHRASHTEDISVCTLPLSALFK
NT seq 1929 nt   +upstreamnt  +downstreamnt
atggagcatcttcaagggtcctggaaaaacatcagtcatgggtttggatgcaaagactct
gtgtttgaagattcctgcatgtctcccaccattctcaagaacttcccgtaccggagatta
tccgacggcagaatcccagacccgaaaactagcagcacgatccgcgtctacctgcccaac
aagcagcggactgtggtgaatgtgcgagcgggtatgacgctgcgcaactgcctcatcaaa
gccctgaaggtccgagggcttcagccagaatgctgcgcggttttcaagctccatcgagaa
cattcatttaagaagttgcatatggattggagcactgactctagctcgctggtcggagag
gagctgctggtggaagtcttagatcacgtacccctgactacgcacaattttgtacagaaa
acgttcttgaagttggccttttgtgacatctgtcagaagtttcttttgcacggcttcaga
tgtcagacgtgcggctacaagtttcacgagcactgcagcaccaaagtgcccacgatgtgt
gtggactggagcaacatccgccagctcctgctgttccccactcctggagagaacgggact
ccgtcgctgcctcctcgctcatcccggcgcatgcacaactctaaattctccttcagtccc
tatcacagatactccacgccaaacgctttaagctacatcagccccatgccgtgcgctggc
gtgtctctcagtcgtaaagtgctgtccacctccactcctaacgtgcacatggtgagcacg
ctccacgagactgctgcgtttcaggaagccttggggcgagacgagtcagggagcccgacg
gactgctccagaaccccggctccggcgcacagggagaaagcaccttcgaacaacactcag
gagaaacgcctccgtcccagagagaagagagattccagctattactgggagatcgaggcc
acggaggtgcttctgctctccaggatcggctctgggtcttttggcacggtttacaaaggg
aagtggcacggcgatgttgctgtgaagattttaaaggtcaccaatcccacaccagagcag
ctacaggcctttcgcaatgaagtggctgttctcaggaagaccaggcacgtcaatatcgtt
ctgtttatgggatacatgaccagggcaaacttggccattgtgacgcagtggtgtgaagga
agcagcctctacaaacatctgcatgtgcaggagaccagcttccagatgctccagctgatg
gacatcgccagacagacggcgcagggcatggattacctacatgcaaagaacatcatccat
cgagacatgaagtcaaacagtatctttgacgtgtttctgcactgcactggtgaagaggtg
aagcatcgctgccacagaagctcagatatcgtcctgcatgaagggttgacggtgaagatc
ggtgattttggtctggccacagtgaaagcgcggtggagcggctctcatcgagtggagcag
ccatccggctctgttctgtggatggctcctgaggtcatccggatgcaggacagtaatccg
cacagttttcagtcggatgtgtactcgtacgggatcgtcctgtacgagctgatgacggga
gaactgccttactctgggattggaaatagagatcagatcatcttcatggtggggagaggc
tatctgacccctgacctcagtaaactctacaagagctgtcccaaagccatgaagagactg
gtggccgactgcatgcagaagtccagagacgaccggccgctgtttccacaggtcctgtcc
tcgatcgagctgctccagcactcgctgcctaagatcaaccgcagcgcgtccgagccgtcg
ctccacagagcctcgcacaccgaggacatcagcgtctgcacactgccgctctccgctctc
ttcaagtga

KEGG   Sinocyclocheilus anshuiensis: 107684881
Entry
107684881         CDS       T04917                                 

Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase-like isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04270  Vascular smooth muscle contraction
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04540  Gap junction
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107684881
   04012 ErbB signaling pathway
    107684881
   04370 VEGF signaling pathway
    107684881
   04371 Apelin signaling pathway
    107684881
   04068 FoxO signaling pathway
    107684881
   04150 mTOR signaling pathway
    107684881
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107684881
  09143 Cell growth and death
   04210 Apoptosis
    107684881
   04218 Cellular senescence
    107684881
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107684881
   04540 Gap junction
    107684881
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107684881
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107684881
  09152 Endocrine system
   04910 Insulin signaling pathway
    107684881
   04912 GnRH signaling pathway
    107684881
   04914 Progesterone-mediated oocyte maturation
    107684881
   04916 Melanogenesis
    107684881
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107684881
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107684881
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107684881
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107684881
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   107684881
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 107684881
NCBI-ProteinID: XP_016336739
LinkDB
Position
Unknown
AA seq 610 aa
MEQLQGAWRSITNSLGMKESVFESSCMSPVIQGVPCQHRSSDDSRTSRTIRAFLPNQQRT
VVNVRPGLTLHSCLIKALKVRGLQPECCAVFSLHPGQSSKKSRMDWNTDSTSLIGEELLV
EVLDHVPLTTHNFVRKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDWT
NIRQLLLFPTPGESGTPSLPALTSRRMRESLTRIPSSFSSAYPPSGAALTQRLRSTSTPN
VCATVAVDSSQIEDAIRIHNSASSSPDQSPTGWNLHNMAQRERAPSLNPQVKIRPRDKRD
SSYYWEIEANEVVLLNRIGSGSFGTVHKGKWHGDVAVKILKVTKPTPEQFEAFRNEVAVL
RKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETNFQMFQLIDIARQTAQGMD
YLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKARWSGSQQVEQTSGSILWMAPEVI
RMQDCNPYSFQSDVYSFGIVLFELMTGELPYSQIANRDQIIYMVGRGYLSPDLSKLYKSC
PKAMKRLVADCIKKSKDERPLFPQILSSIELLQHSLPKINRSASEPSLHRASQSEDISSF
TLTSMKLPVF
NT seq 1833 nt   +upstreamnt  +downstreamnt
atggagcagcttcagggagcatggagatccatcaccaacagtctgggaatgaaggagtct
gtgtttgagagctcatgcatgtctcctgtgatccaaggagtgccatgtcagcaccgctcc
tcagacgactccagaaccagccgcaccatccgagccttcctacccaaccagcagcggacc
gtggtgaatgtacggccaggcctgacgctccacagctgtctgatcaaagcgctgaaggtt
cgagggctccagccggagtgctgcgctgtcttcagtctccatccgggacagagtagcaag
aagtctcgtatggactggaacacagactctacctcgctcattggggaggaacttctagtg
gaggttttggaccatgttcccttaactacacacaattttgtaagaaaaacatttctgaaa
ttggctttctgcgacatatgccagaagttcctcttgaatggtttccgttgccaaacatgt
ggctacaagttccatgagcactgcagcacaaaagtgcccacaatgtgtgtcgactggacc
aacatcagacaactgctattgtttccgactcctggcgagagtgggactccatctctccct
gcacttacatctcggagaatgagggaatccctgacgaggatccctagcagtttctccagc
gcttaccccccatctggagcggctctgacacagagactgcgctccacctccactcccaat
gtctgcgccacagtggctgtcgacagcagccagatcgaggacgccatacgcattcacaat
tcagctagcagctctccggatcagagtccaacaggctggaacctgcacaatatggcccag
agagagcgggctccgtccctgaaccctcaggttaaaattcggccgagggataagagagac
tcgagctattactgggagattgaagctaacgaggtcgtgctgctgaacaggatcggctcg
ggctcctttggaaccgtacacaaagggaaatggcatggtgatgtggctgtgaagatatta
aaagtcaccaagccgacaccggagcagtttgaagccttccgcaacgaggtggcggttctt
aggaaaaccagacatgtcaacatcctgttgttcatgggctacatgacaaaagacaatctt
gcgattgtgacgcagtggtgtgaaggcagcagtctctacaaacacctccatgtgcaagag
accaacttccagatgtttcagctgatagatatcgccagacagaccgctcagggcatggac
tatctacatgcaaaaaacatcatccaccgtgacatgaaatcaaacaacatcttcttacat
gaaggcctgacagtgaagatcggcgattttgggctggccacagtgaaggccaggtggagc
ggttctcagcaggtggaacaaacatcgggatctattttatggatggcacctgaggtgatc
cgaatgcaggactgcaacccgtacagcttccaatctgacgtgtattcttttggcattgtg
ctgtttgaattaatgactggggagctgccctactcacagatagctaaccgagatcagatc
atctacatggttggtcgaggatatctgtctccagacctcagtaagctctataagagttgt
cctaaagccatgaagagactggtggctgactgtatcaagaagtccaaggatgagaggcct
cttttcccccagattctgtcctccattgagctgctgcagcattcgctgcccaaaatcaac
cgcagcgcctctgaaccctcgctgcacagagcatcacagagtgaagacatcagctccttc
acactcacctccatgaagctgcccgtcttctag

KEGG   Sinocyclocheilus anshuiensis: 107687309
Entry
107687309         CDS       T04917                                 

Gene name
raf1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04140  Autophagy - animal
sanh04150  mTOR signaling pathway
sanh04210  Apoptosis
sanh04218  Cellular senescence
sanh04270  Vascular smooth muscle contraction
sanh04370  VEGF signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04540  Gap junction
sanh04625  C-type lectin receptor signaling pathway
sanh04810  Regulation of actin cytoskeleton
sanh04910  Insulin signaling pathway
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
sanh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107687309 (raf1)
   04012 ErbB signaling pathway
    107687309 (raf1)
   04370 VEGF signaling pathway
    107687309 (raf1)
   04371 Apelin signaling pathway
    107687309 (raf1)
   04068 FoxO signaling pathway
    107687309 (raf1)
   04150 mTOR signaling pathway
    107687309 (raf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107687309 (raf1)
  09143 Cell growth and death
   04210 Apoptosis
    107687309 (raf1)
   04218 Cellular senescence
    107687309 (raf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107687309 (raf1)
   04540 Gap junction
    107687309 (raf1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107687309 (raf1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107687309 (raf1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107687309 (raf1)
   04912 GnRH signaling pathway
    107687309 (raf1)
   04914 Progesterone-mediated oocyte maturation
    107687309 (raf1)
   04916 Melanogenesis
    107687309 (raf1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107687309 (raf1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107687309 (raf1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107687309 (raf1)
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107687309 (raf1)
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   107687309 (raf1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 Kdo
Other DBs
NCBI-GeneID: 107687309
NCBI-ProteinID: XP_016340075
UniProt: A0A671MWK8
LinkDB
Position
Unknown
AA seq 629 aa
MMEHIQGAWKSISHGIGCKDSVFEESCMSPTILNNFPYRRLSDDGRIPDSKTSSTIRVYL
PNKQRTVVNVRPGMTLRNCLIKALKVRGLQPECCAVFKLHREHSFKKLRMDWSTDSTSLV
GEELLVEVLDHVPLTTHNFVRKTFLKLAFCDICQKFLLHGFRCQTCGYKFHEHCSTKVPT
MCVDWSNIRQLLLFPTPGENGTPSLPPLSSRRMQNSKFSFSPYHRYSTPNALNYITPMPS
PGVSLSHKVLSTSTPNVHMVSTTQPVDEAAYQEALGRDESGSPQDQSPTEWSKTPAPAHR
EKAPSTNTQEKRIRPREKRDSSYYWEIEATEVVLLSRIGSGSFGTVYKGKWHGDVAVKIL
KVTNPTPEQLQAFRNEVAVLRKTRHVNIVLFMGYMTKANMAIVTQWCEGSSLYKHLHVQE
TNFQMFQLMDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKARWS
GSHRVEQPSGSVLWMAPEVIRMQDNNPYSFQSDVYSYGVVLYELMTGELPYSMIGNRDQI
IFMVGRGYLTPDLSKLYKSCPKAMKRLVADCIQKSKDDRPLFPQILSSIELLQHSLPKIN
RSASEPSLHRAAHTEDINVCTLALSSAFK
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgatggagcatattcaaggggcctggaaaagcatcagtcatgggattggatgcaaagac
tcggtatttgaagaatcctgcatgtctcccaccattctcaataacttcccgtaccggaga
ttatcagatgacgggagaatcccagactcgaaaactagcagcacaatccgcgtctacctg
cccaacaaacagcggactgtggtgaacgtgcgaccaggtatgacgctacgcaactgcctc
atcaaagccctgaaagtccgtgggcttcagccagaatgctgtgctgttttcaagcttcat
cgagaacattcatttaaaaagttgcgcatggattggagcactgattctacctcactggtc
ggagaggagctgctggttgaagtcttagatcacgtacccctgactacgcacaattttgta
cgaaaaacctttttgaagttggccttttgtgacatatgtcagaagtttcttttgcacggc
ttcagatgtcagacgtgcggctacaagtttcacgagcactgcagcaccaaagtgcccacg
atgtgtgtggactggagcaacatccgacagctcctactgttcccgactcccggagagaac
gggactccatcgctccctcccctctcatcccgtcgcatgcagaactcgaaattctccttc
agtccctatcacagatactcgacgccaaatgctttaaactacatcacccccatgccgtcc
ccgggtgtttctctcagtcataaagtgctgtccacatccacccccaacgtccacatggtg
agcaccacccagccggtcgatgaagctgcttatcaggaagccttagggcgagatgaatcc
ggaagccctcaagatcagagcccgacggagtggtccaaaaccccggctccagctcacagg
gagaaagcgccttcgaccaacactcaggaaaaacgcatccgtcctcgagagaagagagat
tccagctactattgggagatcgaggccactgaggtggttctgctctccaggatcggctca
gggtctttcggcacagtttacaaagggaagtggcatggtgatgttgctgtgaagatttta
aaggtcacgaatcccacaccagagcagttacaggcctttcgcaacgaagtagctgttctc
aggaagaccaggcatgtcaatattgttttgtttatgggatacatgaccaaggcaaacatg
gccattgtgacgcagtggtgtgaaggaagcagcctctacaaacatctgcacgtgcaggag
accaacttccagatgttccagctgatggacatcgccagacagacggctcagggcatggat
tacctacatgcaaagaacatcatccatcgagacatgaagtcaaataatatcttcctgcat
gaagggttgacggtgaagatcggtgattttggtctggccacggtgaaggcgcggtggagc
ggctctcatcgagtggagcagccgtctggctctgttctgtggatggctcctgaggtcatc
cggatgcaggacaacaatccttacagttttcagtcggatgtatactcgtacggtgtcgtc
ctgtacgagctgatgacaggagaactgccttattctatgattggaaatagagatcagatc
atctttatggtggggagaggctatctgacccctgacctcagtaaactctacaagagctgt
cctaaagccatgaagagactcgtcgccgactgcatccagaagtccaaagacgacagaccg
ctgtttccgcagatcctgtcctcgattgagctgctccagcactcgctccccaaaataaac
cgcagcgcgtccgagccgtcgctccacagggccgcgcacaccgaggacattaacgtctgc
actctggcgctttcatccgccttcaagtga

DBGET integrated database retrieval system