KEGG   Sinocyclocheilus anshuiensis: 107679396Help
Entry
107679396         CDS       T04917                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type-like isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00010  Glycolysis / Gluconeogenesis
sanh00030  Pentose phosphate pathway
sanh00051  Fructose and mannose metabolism
sanh00052  Galactose metabolism
sanh01100  Metabolic pathways
sanh01200  Carbon metabolism
sanh01230  Biosynthesis of amino acids
sanh03018  RNA degradation
Module
sanh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107679396
   00030 Pentose phosphate pathway
    107679396
   00051 Fructose and mannose metabolism
    107679396
   00052 Galactose metabolism
    107679396
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    107679396
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sanh01009]
    107679396
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sanh03019]
    107679396
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     107679396
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107679396
Messenger RNA biogenesis [BR:sanh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     107679396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 107679396
NCBI-ProteinID: XP_016330401
LinkDB All DBs
Position
Unknown
AA seq 835 aa AA seqDB search
MPDTKKFIENLSGAGKCIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIHEGYQGMVD
GGDNIKEASWESVSSMLQVGGTVIGSARCKDFRTHEGRLRAALNLVQRGITNLCVIGGDG
SLTGANLFREEWSGLLDELVQSGEISEEASQIYSALHIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPKDGWE
EQMCYKLSENRADKKRLNIIIVAEGAIDQSNKPITTELIKDLVVRCLGFDTRVTVLGHVQ
RGGTPSAFDRILASRMGVEAVLALLEASPGTPACVVSLCGNQAVRVPLMECVQMTQEVQK
AMDEKRFEEAVRLRGRSFENNLNTYKLLSHRKIDSELPHSSFNVAVLNVGAPAAGMNAAV
RSAVRVGITEGHTMFAVSDGFEGFYKGQIKEIKWGDVGGWTGQGGSLLGTKRTLPAKHID
KIAEQMRIHNINALLVIGGFEAYLGLMELQAARSKHAELCVPMVMVPATVSNNIPGSDLS
IGADTALNAITDAFESLLQLVDARSRYEEFCVPMCMLPATISNNVSGTDLSIGADTSLNA
IVETCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGADAAYIYEEPFDIRELQSN
VEHLTEKMKTSIQRGLVLRNENCSENYTTDFIYQLYNEEGKGVFDCRKNVLGHMQQGGAP
SPFDRNFGTKIAAKAMQWISKKLKEFYREDEGRVFANTEDSACLLGMRRRALVFQPVVQL
KDETDFVHRIPKEQWWLRLRPLMKILAKYKTSYDVSDSGQLEHIVRLRAKDVSAI
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgccggacaccaaaaaattcatcgagaacctgtctggagcagggaagtgcattggcgtc
ctgacaagtggcggagatgctcaaggtatgaatgctgctgtgagggcagtggtcagaatg
ggaatctatgtgggagcaaaagtttattttattcatgagggctaccagggcatggtggat
ggaggtgacaacatcaaagaggcatcatgggaaagtgtttccagtatgttacaagtgggt
ggcaccgtgattggcagcgcccgctgtaaggattttcgcacccacgagggccgtttgcgt
gctgctctgaacctggtgcagcgtggcatcactaacttgtgtgtgattggtggagatggc
agtttgaccggggctaatctcttcagggaggagtggagcggactgttggatgagcttgtc
caatcaggtgaaatcagtgaagaggcttcccaaatttattctgcattgcatatcgttggg
atggtgggctcaatagacaatgatttctgtgggacagatatgaccattggcactgactca
gcattgcacaggatcatagaggtggtggacgccataatgaccacggcacaaagccatcag
aggacctttgtgctggaggtcatgggaagacactgcgggtatctagcattagtcagtgct
cttgcatgtggagctgactgggtgctgattccagaaatgcctcccaaagatggctgggag
gaacagatgtgttataaactatcagagaatcgtgctgataagaaacggcttaatatcatc
atagtagctgaaggtgcaatagaccaaagcaacaagcccataaccacagaacttataaag
gatctggtggtgcgctgtttggggtttgacacgcgggtcaccgttctgggtcacgtccag
agaggaggaacaccctctgcctttgaccggattttggcgagtcgtatgggagtggaagcc
gtcttggccctgttagaagcgtctcctggtactccagcatgtgtggtgtctctgtgtggg
aaccaggctgtcagggttcctctgatggagtgcgttcagatgacgcaggaggtccagaag
gccatggatgaaaagcgatttgaagaagctgtaaggctgcgtggcagaagtttcgaaaac
aacctgaacacttataaactcttgtctcatcgaaaaattgattctgaacttccacatagc
tcatttaatgtggctgtgttgaatgttggcgctcctgcagctggcatgaatgcagccgtg
cgttcggccgtcagggttggcatcaccgaaggccacactatgtttgctgttagtgatggg
tttgagggcttctataagggacagattaaagaaatcaagtggggtgatgttgggggctgg
acaggccagggcgggtccctgctaggaacaaaaagaactctcccagccaagcacattgat
aaaattgcagaacagatgaggattcacaacatcaacgctttactggttattggaggtttt
gaggcttatttggggctgatggagctgcaagcagctcgttccaaacacgcagagctttgt
gttcccatggtgatggtcccggccactgtgtccaacaatatccccggctcagacctgagt
atcggggcagacacggccctcaacgcaatcacggacgcctttgagagtttgctgcagctg
gtcgatgcccgcagcaggtatgaggagttctgcgtgcccatgtgcatgctgcctgccacc
atcagtaataatgtgtccggcactgacctcagcattggcgctgacacttccctcaatgcc
atagtggagacgtgtgatcgtataaagcagtcggccagtggaaccaagcgccgcgtgttc
atcattgagacgatgggcggttactgtggttacctggcgacggtgggcgggctggcggcc
ggagcggatgcagcctacatctatgaagagccgtttgacatccgagaactacagtctaac
gtcgaacatttaactgagaagatgaagaccagcatccagagaggtttagtgctcaggaat
gagaactgtagtgagaactacaccactgacttcatctaccagctgtacaatgaagagggc
aaaggagtctttgactgcaggaagaacgtgctgggacacatgcagcagggtggtgctcct
tccccgtttgacaggaactttggcactaagatcgcagctaaagccatgcagtggatctcc
aagaagctcaaagagttttacagagaagatgaaggacgtgtgtttgcgaacacagaggat
tctgcgtgtttgttggggatgcggcgaagggctctggtctttcagcccgtcgtacagctg
aaggatgagacggattttgttcacaggatcccgaaggaacagtggtggctccgtctgcgt
cctctcatgaagattctggccaagtacaaaaccagctacgatgtgtccgattctggccag
cttgaacacatcgtccgcctgagagctaaagacgtctctgccatttaa

DBGET integrated database retrieval system