KEGG   Sinocyclocheilus anshuiensis: 107679537Help
Entry
107679537         CDS       T04917                                 

Definition
(RefSeq) transmembrane protease serine 2-like
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sanh01002]
    107679537
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     107679537
Peptidases [BR:sanh01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107679537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 SRCR Trypsin_2 Ldl_recept_a Hepsin-SRCR
Motif
Other DBs
NCBI-GeneID: 107679537
NCBI-ProteinID: XP_016330600
LinkDB All DBs
Position
Unknown
AA seq 500 aa AA seqDB search
MQTTDTTYDNVSHVNHGFQHEEQRPPPYAPSSGINPPLPQYPGSQNSAPPYFSERYSPAQ
SLHQYTPHTAPVNTHHTVTPGLYLDVNPVHKASRRKKWPFILCIVITLLVVAGVIAAVLW
FYGGFDCLQGRRCKTDNKCVSFSQRCDGVQDCPSGDDETHCFRLYGSNSLLQMYSHVTQK
WENVCLDGWNDNLGMQACEEMGYERNTYEGYEEIYSRASSDYMLVKTDSPSSFNLTSFLS
KSSDCPSNKAVALKCIDCGRNNGRRIVGGTTVNSKGVWPWQVSLQISGNHLCGGSVITPY
WIITAAHCVYEFSNARDWTVYAGYLTRAEMRSATGNSVSRIVMHNFDPRTNENDIALMKL
NRPLTITLDVRPVCLPHKGMYFAAPRECYVTGWGALFSGGPSSQTLQEAKIQLIDRTTCN
SRAVYNGQITDTMICAGKLEGGVDSCQGDSGGPLVIKENSLWWLVGDTSWGDGCAFRNKP
GVYGNVTYFLDWIHEQMRRY
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgacagatacgacttacgacaatgtttctcacgtgaaccatggtttccaacat
gaagagcagcggccccctccatatgcaccttcttctggaataaacccgcctttacctcag
taccccggttcccagaattccgctccaccatacttttcagagagatactcgcctgctcag
agcctgcatcagtatacgcctcacacagcacctgtaaacacacaccacacggtcacacct
ggactctaccttgacgttaatccggttcacaaagcttccaggagaaaaaaatggccattt
atcctttgcatagtcatcaccctactggtcgttgctggggtcatagctgcggtgctttgg
ttttatggtgggtttgattgtttgcaagggcgtcgctgtaaaacagataacaaatgtgtc
agcttctcgcagcggtgtgacggcgtgcaggactgtccatcgggagacgatgaaactcat
tgctttcgtctgtatggatctaattcccttcttcagatgtactcacatgtgacccaaaaa
tgggagaatgtgtgtttagatggatggaatgacaacctcggaatgcaagcatgtgaggag
atgggatacgagaggaacacttatgagggttatgaggagatttactctagagcatcgtct
gactacatgctggtgaagacggattctcccagctctttcaatctgacaagttttctcagt
aaaagttcagactgtccatctaacaaagcagtggcactcaaatgtatagattgtggacgg
aacaacgggagacgaatcgtgggaggaaccactgtgaactcaaagggggtgtggccatgg
caggtcagcctgcaaatttctggaaaccatttgtgtggcgggtctgtcattacaccttac
tggatcatcactgcagctcactgtgtttatgagttttccaatgcaagggattggactgtg
tatgctggatatctgactcgtgctgagatgcggtcggccactggcaattctgtaagccga
atcgtcatgcacaactttgacccgaggaccaacgaaaatgacattgctctgatgaagcta
aaccgtccactcacaattacattggatgtcaggccagtgtgtctgccccataaaggcatg
tactttgctgctccgcgggaatgttacgtcactggatggggggcactgtttagtggaggc
ccttcctcacaaaccctacaagaagccaaaatccagctaatcgacagaacgacttgcaac
agccgagcagtgtataacggacaaatcacagacaccatgatctgtgctggcaagctggag
ggcggcgtggactcctgtcagggggacagtgggggtcctctggtcataaaggagaattct
ctatggtggctggttggggacactagctggggtgatggatgtgctttcagaaacaagcct
ggagtctacggaaatgtgacctacttccttgactggatacatgaacaaatgcggagatat
tag

DBGET integrated database retrieval system