KEGG   Sinocyclocheilus anshuiensis: 107679601
Entry
107679601         CDS       T04917                                 

Definition
(RefSeq) kit ligand-like
  KO
K05461  KIT ligand
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107679601
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107679601
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sanh04052]
    107679601
Cytokines and growth factors [BR:sanh04052]
 Growth factors
  Growth factors (RTK binding)
   107679601
SSDB
Motif
Pfam: SCF TMEM154 DUF3439
Other DBs
NCBI-GeneID: 107679601
NCBI-ProteinID: XP_016330683
UniProt: A0A671PW86
LinkDB
Position
Unknown
AA seq 272 aa
MKKSNIWICTCVHLLLYMTVAAYSSELGNPITDDIKKISLLKQNIPKDYKITLRYIPKEV
SGMCWVKLNVFHLEVSLKGLAQKFGNISSNKDNMGTLVQILQEMRYHIGHGLEDSMLEFD
CHYVNEMWLTAKYFEFVEDFFNTANSSRDVEDCEPPPCPTSTKTTVTTTTTASTTSAQHS
TNEKRNGLPDDPEKGAFLPKVVQSSLMSLLAIPFIAVVVFLMIWKIKSRRNAPQTERSPE
EGPALFSGEEANIPPLEVEISEKNRLNIIMAV
NT seq 819 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaacatttggatatgcacctgtgtccatttattgctgtacatgacagtt
gctgcctattccagtgaattaggaaatcccattacagatgacatcaagaagatttctttg
ttgaaacagaatattccaaaagactacaagattacattacgttatatacctaaagaagtg
agtggtatgtgctgggtaaagctaaatgtatttcacttggaggtgagcttaaaaggcctg
gcgcagaagtttgggaacatatcctccaataaagataatatgggcactttggtccaaata
ctgcaagagatgcggtatcacattggacatggcttggaggattcaatgctagaattcgat
tgtcactacgtaaatgagatgtggcttacggcaaagtattttgaatttgtggaggacttt
ttcaacactgccaattcgtcaagggatgttgaggattgtgagcccccaccatgtcccaca
tccacaaaaacaacagtaacgacaactacaacagcgtcgacaacgtcagcgcaacatagt
acaaatgagaaacgtaacggtttgcctgatgaccccgaaaaaggggcattccttccgaaa
gttgtgcagagcagtcttatgtcgctcctagccatcccgttcatcgccgtggtggtgttt
ctgatgatctggaagattaaatctagaagaaacgcccctcaaactgaacgaagtccggaa
gaaggtcccgcccttttctcaggagaggaagccaatatacccccattagaagtggagata
tctgaaaaaaacagattaaatattatcatggcagtgtaa

DBGET integrated database retrieval system