KEGG   Sinocyclocheilus anshuiensis: 107683740Help
Entry
107683740         CDS       T04917                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase-like, mitochondrial
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00020  Citrate cycle (TCA cycle)
sanh00310  Lysine degradation
sanh00380  Tryptophan metabolism
sanh01100  Metabolic pathways
sanh01200  Carbon metabolism
Module
sanh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sanh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sanh_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107683740
  09105 Amino acid metabolism
   00310 Lysine degradation
    107683740
   00380 Tryptophan metabolism
    107683740
Enzymes [BR:sanh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     107683740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 107683740
NCBI-ProteinID: XP_016335290
LinkDB All DBs
Position
Unknown
AA seq 1050 aa AA seqDB search
MGRIDVGEIIGEKTNSSLNQTTQNAFELKRTIFICGQPSFSDMSQLRSLAGALRSSSQWM
RGHVGTGRRVFDPRRNCLSRAAEPSLAACSSSYVVEMYYAWLEDHKNVHESWDAYFRNAQ
ASGSEETGEKRLSALLQGRAMSQTPAMSEKVVEDHLAVHSLIRAYQVRGHHVARLDPLGI
LTADLDSFVPSDLITSIDKLGSYGLEKSDLDKSFQLPLTTFIGGNESTLPLREIIHRLET
SYCGHTGVEFMFINNMEQCQWIRQKFETPGIMMFSDREKRTLLARLVRSTRFEDFLARKW
SSEKRFGLEGCEVLIPALKMIIDKSSEAGIENVIMGMPHRGRLNVLANVVRKDLDQIFCQ
FDPKLEAADEGSGDVKYHLGMYHERINRETDKNITLSLMANPSHLEAVDPVVQGKTKAEQ
FYRGDTEGRMVMSILMHGDAAFAGQGVVYETFHLSELPSYTTHGTIHVVVNNQIGFTTDP
RMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCKVAAEWRNTFNKDVVIDLVCYRRFG
HNEMDEPMFTQPLMYKQIRKQEHVLKKYADKLISEGVVTLQEFEEEVAKYDKICEEAYTS
SKDEKILHIRHWLDSPWPDFFKPDGEPKSMSCPSTGLNEEVLRHIGEVASSVPLKDFAIH
SGLSRILRGRADMVAKHTMDWALAEYMAFGSLLKDGIHVRLSGQDVERGTFSHRHHVLHD
QEVDKRFCIPMNHLWLNQALYTVCNSSLSEYGVLGFELGFAMASPNALVCWEAQFGDFQN
TAQCIIDQFISAGQAKWVRHNGIVLLLPHGMEGMGPEHSSARPERFLQMSKDDPDRYPEF
TGDFEVQRLYDCNWIVVNCSTPANYFHVLRRQILLPFRKPLIIFTPKSLLRLPEARSSFD
EMITGTKFLRIIPDGGPASKHPEKVKRVIFCTGKVYYELAKERKQLKLEEDVAIVRLEQI
SPFPFDLIKAEVEKYSNAELIWCQEEHKNMGYYDYIRPRFLTVHSKNPIWYVGRDPAAAP
ATGNKFTHLAELKRFLDTAFNLEAFKGRSF
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgggacggattgacgttggagagattataggagagaaaacaaactccagcctgaatcaa
acgacacagaacgcatttgaactcaagcggaccatcttcatctgcgggcagccaagtttt
tcagacatgagtcagctgaggtccctagctggtgccctaagaagcagtagccaatggatg
agggggcacgtggggacagggaggcgagtttttgacccacgtcgtaactgtttgagcagg
gctgctgagccctcattggcagcctgcagctccagctatgtcgtggagatgtactacgct
tggctggaggatcacaaaaatgttcatgagtcttgggatgcatactttcgtaacgcccaa
gccagtggttcagaggagactggagagaagcgtctgtctgcgctgctccaggggcgagcc
atgtcccagacacctgccatgtccgagaaggtggtggaggatcatttggcagtccacagt
cttatcagagcctatcaggtacgtggtcaccatgtggccaggctggaccctcttggcatc
ctcactgccgatctggattcattcgttccctcagatttaatcacgtcaattgacaagctt
gggtcctacggcttggaaaaatctgatctggataaatcatttcagttgccactaaccaca
tttatcggaggaaatgaaagcacactcccactgagagaaatcatacacagacttgagaca
tcatactgtggtcatactggagtggaattcatgttcatcaacaatatggagcagtgccag
tggatccgacagaagtttgaaactccaggaatcatgatgttttctgacagagagaagagg
actttgctggccaggctggttcgctcaacacggtttgaggattttcttgctcggaaatgg
tcttcagagaaacgctttggtttggaaggctgtgaggttctcatccctgccctgaagatg
ataattgacaagtccagtgaagctggtatagagaatgtaattatgggaatgcctcacaga
ggccgactgaacgtcctggccaatgtagttcgcaaagatctggatcaaatattctgtcag
ttcgatcccaaacttgaggctgcagatgagggttcaggagatgtgaaatatcacttgggg
atgtaccatgaacggataaacagggaaacagataagaatatcacattgtctctgatggca
aacccctctcacctagaggcagtagatcctgtcgttcagggcaagaccaaggcagagcag
ttttacagaggagacactgaaggaaggatggtgatgtctattttaatgcatggtgacgct
gcttttgcgggtcagggagtcgtctacgaaaccttccatctcagtgaactgccttcatat
accactcatggcaccatccatgttgtggtcaataatcagattggattcaccacagatccc
cgaatggcacgttcctctccctacccaacggatgtggctcgcgtagtcaacgcacccatc
ttccatgtcaacgctgatgacccagaggctgtgatgtatgtttgtaaggttgctgcagaa
tggagaaacactttcaacaaggatgtggtgatagacctggtgtgttaccggcggtttgga
cataatgagatggatgagcccatgttcactcaacccctcatgtacaagcagatccggaaa
caggaacatgtgctgaagaagtacgccgacaagctcatctctgagggagttgtaacactg
caagagtttgaggaggaggttgctaaatatgacaagatctgtgaggaggcgtataccagc
tctaaagatgagaagatcctacacatccgccactggcttgactctccgtggccagacttc
tttaaaccagatggagagccaaagagcatgagctgcccttccactggattaaacgaagag
gtgctcaggcacattggtgaggtagccagttcagtccctctgaaggattttgcaattcac
agtggcttgtcacgcatccttcgaggcagagcagatatggttgcaaagcacacgatggac
tgggccctggcagagtacatggccttcggctctttgctgaaggatggtattcacgtgaga
ctcagtggacaagatgtggaaagaggaacatttagtcaccgtcaccacgtcttgcatgat
caggaagttgataagcgcttctgcattccgatgaaccacctatggctgaaccaggctctc
tacacagtgtgcaacagctccctgtctgaatatggggttttggggtttgagctgggtttt
gccatggctagtcctaatgccctggtgtgctgggaggctcagtttggcgacttccaaaac
acagcccagtgcatcatagaccagttcatctctgcaggccaggccaagtgggtccgccac
aatggcatcgttttactgttgcctcatgggatggagggaatgggcccggagcactcgtca
gcacggcctgagcgcttcctgcagatgagcaaggatgaccctgatcgctatccggaattc
actggagactttgaggtccagcggctctatgactgtaactggatcgtggtcaattgttca
acacctgccaactacttccatgtgcttagaaggcaaatcttattaccattcagaaagcca
ctgatcattttcacaccaaagtctttactgaggctgcccgaggcacgctccagtttcgat
gagatgatcacagggacaaaattcctaaggataattccagatggtggtcctgcatccaaa
cacccagaaaaagtcaaaagggtcatcttctgcaccggaaaagtgtactatgagctggca
aaagagagaaaacagctgaagttggaggaggatgttgcaattgtcagattggagcagata
tcacccttcccttttgacctcatcaaggctgaggttgagaagtacagcaatgctgaactc
atatggtgtcaagaggagcacaagaatatgggctactatgattacataaggccacgtttc
ctcacagtgcactctaagaatccaatatggtatgttggccgtgaccctgctgcagcccct
gccactggaaacaaattcactcatctggctgagctgaagaggttcttggacactgcgttt
aaccttgaggctttcaagggcaggagtttttga

DBGET integrated database retrieval system