KEGG   Sinocyclocheilus anshuiensis: 107685038
Entry
107685038         CDS       T04917                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04080  Neuroactive ligand-receptor interaction
sanh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107685038
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107685038
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sanh04030]
    107685038
G protein-coupled receptors [BR:sanh04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    107685038
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 107685038
NCBI-ProteinID: XP_016336950
UniProt: A0A671M5M1
LinkDB
Position
Unknown
AA seq 359 aa
MVCHDNETVSFFYNLSKKSISDTWRPKDVVVVSLGLLVCAFVIFANILVMLAIFINRRFH
YPIYYLLGNLAAADLFSGISYLYLMFHTGPWTSKLSIHEWFVRQGLIDTSLTASVINLMA
IALERHQTIFTMQLHSKMTNHRVVLLIVGIWLIAIVLGLVPSMGWSCVCNLQQCSNMAPL
YSRSYLVFWAVLNLLTFTVMVAVYTRIFIYVRRKSHRMSQHTSQAKHKETVVNLMKTVVM
ILGCFVVCWTPGLVLLLLDSSCESCDVLTYEKFFLVMAECNSFMNPIIYSYRDKDMRDTF
KRILCFPCLGSQQKGEHSGVRFNTLEQEARRAREGDGDQANGGQVVLKDAENMLDSTES
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggtttgccacgacaacgaaactgtgagtttcttctacaacctcagcaagaagagcatc
agcgacacgtggaggcccaaagacgtggtggtggtgtccctgggcctgctggtctgcgcc
ttcgtcatcttcgccaacatcctggtcatgctggccatcttcatcaaccgcaggttccac
taccccatctactacctgctggggaacctggcggcggccgacctgttctccggcatctcc
tacctgtacctgatgttccacacgggcccctggaccagcaagctctccatccatgagtgg
tttgtgcggcagggtttgatcgacaccagtctgacggcgtccgtcattaatctgatggcc
atcgcgctggagcgccaccagaccatcttcaccatgcagctgcacagtaagatgaccaac
caccgggtggtgctgctgatcgtgggcatctggctcatcgccatagtgctgggtttggtg
ccctctatgggctggagctgcgtctgcaacctccagcagtgctccaacatggcgccgctc
tacagccgcagctacctggtgttctgggccgtgctcaacctgctgaccttcactgtcatg
gtggccgtctacacgcgcatcttcatctacgtgcgccgcaagagccaccgcatgagccag
cacacctcgcaggccaagcacaaggagaccgtggtcaacctgatgaagaccgtcgtcatg
atcctgggttgtttcgtggtgtgttggacgccgggactggtgctgcttctcctggacagt
tcgtgtgagtcctgcgacgtcctgacctacgagaagttcttcctggtgatggccgagtgc
aactccttcatgaaccccatcatctactcctaccgcgacaaggacatgcgcgacaccttc
aagcgcatcctgtgcttcccgtgtttggggtcgcagcagaagggcgagcactcgggtgtg
cgcttcaacaccctcgagcaagaggctcgtagggctcgcgagggagacggcgatcaggct
aacggcggacaggtcgtgctgaaggacgcggagaacatgctggactccaccgagagctga

DBGET integrated database retrieval system