KEGG   Sinocyclocheilus anshuiensis: 107685373
Entry
107685373         CDS       T04917                                 

Definition
(RefSeq) adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00230  Purine metabolism
sanh01100  Metabolic pathways
sanh04020  Calcium signaling pathway
sanh04114  Oocyte meiosis
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04371  Apelin signaling pathway
sanh04540  Gap junction
sanh04912  GnRH signaling pathway
sanh04914  Progesterone-mediated oocyte maturation
sanh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107685373
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107685373
   04020 Calcium signaling pathway
    107685373
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107685373
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107685373
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107685373
   04914 Progesterone-mediated oocyte maturation
    107685373
   04916 Melanogenesis
    107685373
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107685373
   04270 Vascular smooth muscle contraction
    107685373
Enzymes [BR:sanh01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107685373
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF3007 HNOBA
Other DBs
NCBI-GeneID: 107685373
NCBI-ProteinID: XP_016337427
LinkDB
Position
Unknown
AA seq 1075 aa
MSVNGTQDGPVTVAEPHTGGGVREITAARGGSLSLPRFMRLKFTPESLEKVYQTYFLRQR
QETLLVLIVFAALFNGYVVIMCAVVYSEDKLKTLAVAAGGLASDILLYILCRFRLLPESV
PRSLVPFALWLLITVHVLCYLSLNFAGFYAAGDTVGWQTFFLFSFFLTLPLPLAPIALLS
ALSCCAHTLLLGFTVAQRHQDKLQLTVLIRQLVANLMLYFAAVLVGMMSYFMADRKYRTA
FLEAKQSLEVSLTLKEQSQQQEELLLSILPKHIADEMLQGMKKGANQKSDAQQFNTMYMY
RHENVSILFADIVGFTQLSSAVTPKELVKLLNELFARFDKLAAQHHQLRIKILGDCYYCI
CGLPDYREDHAVCSIMMGLSMVEAISYVREKTQTEVDMRVGVHTGTVLGGVLGQKRWQFD
VWSTDVTVANKMESGGIPGRVHISQNTKDCLHSEFELEEGNGGERCEYLLEKGIDTYLVL
VSKDTPKTNGVTNGTVINTTKPSGSYTSVKNIPEESETQQLQLANMTDKGMEDEHLNQLL
NKTLLERETKETLEERKTSVLSLRFEDSDLESRYSAEKERRTGVAFSCCCVVLIFTSVME
ILIDPQLIVNYVTLAVGELLLLILTLCSLAAIFPRVFPQRLVSFSQWIDRTRWARNTWAM
AAIFVLTMAEVADMLSCVRPPLVLLNSSTGVTLESLGDGGCAENPKHYGYISVLSLVATV
MLVQLSHVVKLALMLLVTIATVAVNIHSWMYIYDIYDFIRYLDYSYSVVPTRYLLTVMII
IMMMSFYYFARHVERQSRKLFLWKIKVHDQKEKVYEMRTYNEALVTNMLPEHVAKHFLGS
KMRDEELYSQSYDEIGVMFASIPNFSDFYTEEGINNGGIECLRILNEIISDFDSLLDRTE
FRHITKIKTIGSTYMAASGVTPESNTNGYADRKIEDQSILERWQHFADLADFALAMKVTL
GNLNKQSFNNFMLRIGLNKGGVLAGVIGARKPHFDIWGNTVNVASRMESTGVMGNIQVVE
DCYNILKEYGFRFVRRGPIYVKGKGELLTFFMKGKDKPVTKTTAVSLPHQIPDKS
NT seq 3228 nt   +upstreamnt  +downstreamnt
atgtcggtgaacgggactcaggacggtccggttaccgtggcggagccgcacactggcggt
ggcgtgcgcgagataacggcggcgcgtggcggctcgctgtctctgccgcgtttcatgcgt
ctcaagtttacaccggagtctctggagaaagtttatcagacgtattttctgcggcagcgg
caggagacattactggtgctgatcgtgttcgcggccctctttaacggttacgtcgtcatc
atgtgcgcggtggtttactctgaggataaactgaagacgctcgcggtggcggcaggtggg
ctcgcgtcggatattctgctctatattttgtgccggttccgtttgctgccggagtccgtg
ccccggagcctcgtgccgttcgcgctctggctgctcatcacggtccacgtgctgtgttac
ttaagtttgaacttcgcgggattttacgcggccggtgacaccgtcggatggcagacattc
ttcctcttctccttcttcctcacgctcccgctgccgctcgcgcctatcgcgctcctgagt
gcgctctcgtgctgtgcgcacacgctgctgctgggattcaccgtagcgcagagacatcag
gacaaactgcagttaacagtgctgatcagacagctggtggcgaatctgatgctgtatttt
gctgctgtgctggtgggcatgatgtcatatttcatggccgaccgtaagtaccgcacggcg
ttcctcgaggccaaacaatctctggaagtcagtcttacgctgaaggaacagagtcaacaa
caggaggaattgctgttgtctatcttgccgaagcacatagcagatgagatgcttcagggc
atgaagaaaggagccaatcagaaatcagatgctcagcagttcaacaccatgtacatgtac
cgccacgaaaacgtcagtatccttttcgcagacattgtaggttttacacagctgtcttct
gctgtgactccaaaagaacttgtcaaactactcaacgaactctttgctcgcttcgacaaa
ctagcagcacaacaccaccagctgaggatcaagattctgggagactgttattactgtatc
tgcggtttgccagattatcgtgaagatcatgcggtctgctccattatgatgggcctgtct
atggtggaagccatctcatatgtgcgtgaaaaaactcagacagaagtggacatgcgtgta
ggtgtgcacacgggtaccgtacttggtggagtcctgggacagaagcgctggcagtttgat
gtctggtccactgatgttactgtggcaaacaagatggagtcaggaggcatcccagggcgt
gtgcacatctctcagaacacgaaggactgtttgcacagtgagtttgagctggaggagggc
aatggaggagagcgctgcgagtaccttctggagaaaggcatcgacacgtatctggtgctt
gtgtccaaagacactcccaaaacaaacggagtgaccaacggcacagtgatcaacaccaca
aaacccagcggcagctacacatcagtaaagaacatacctgaggagtcagagacacagcag
ctgcagttggccaatatgaccgataaagggatggaggacgagcatctgaaccagctgctg
aataaaactctgctggagagagagacaaaagagactctggaggagaggaagacgtcggtt
ctgtctctgaggtttgaggactctgatctggagtctcgttactcagcagagaaggagaga
cggacgggcgttgcgttcagctgttgttgtgtcgttctgatcttcacctcagtcatggaa
attctcatcgacccacagctgattgtgaattatgtgactctagctgttggtgagctgcta
ctgctgattctgactctgtgttcactagcagctatctttcctcgagtcttcccccagagg
ctggtgtctttctcacagtggatcgaccgcacacgctgggctcgtaacacatgggccatg
gctgccatatttgttctgaccatggctgaggtggccgatatgctgagctgtgttcggccc
cctctcgtgctgctgaactcctcgaccggcgtgacgcttgagtctctgggtgacggcgga
tgcgctgagaaccccaaacactacggatacatatcagtgctgtcgctcgtggcaaccgtc
atgctcgtacagctcagccatgtggtcaagctggcgctcatgctgttggttaccatagca
acagttgccgtaaacatccacagctggatgtacatttacgacatctacgatttcattcgc
tacctggactacagttattcagtggttcccaccagatatctgctgactgtgatgattatc
atcatgatgatgagtttctactactttgcacgtcacgtggaaagacagtcgcgtaaactg
tttctgtggaagattaaggttcacgatcagaaggagaaagtgtatgaaatgagaacgtac
aacgaggcgctggtcactaacatgcttccagaacacgtggccaaacacttcctgggctcc
aagatgcgagatgaggaactttacagtcagtcgtatgatgagatcggcgtgatgttcgcc
tctattcccaacttctctgacttttacacggaggagggtataaacaatggagggatagaa
tgcctccgaatcctgaatgagataatctctgactttgacagtcttctggatcgcacagag
tttcgccacattacaaagatcaagaccatcggcagcacatacatggctgcatcaggcgtg
acgccggagagcaacactaacggatacgccgaccgcaagatagaggatcagtccatcctg
gagcgctggcaacacttcgctgatttggcagactttgcactggctatgaaagtcacactt
ggaaacctaaacaaacagtcgttcaataacttcatgctgcgcataggtctgaataagggg
ggtgtgttagctggagtgattggcgctcgcaaacctcatttcgatatttggggaaacact
gtaaatgtggccagtcgtatggagtccactggggttatgggtaacattcaggtggtggag
gactgctataacatcctgaaggagtacggtttccgtttcgtcagaagaggacccatctat
gtaaaagggaaaggagaactgctcactttctttatgaagggcaaagacaaacctgtcaca
aagacgaccgcggtctctctcccacatcaaataccagacaaatcctga

DBGET integrated database retrieval system