KEGG   Sinocyclocheilus anshuiensis: 107685560Help
Entry
107685560         CDS       T04917                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD2-like
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107685560
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sanh03036]
    107685560
Enzymes [BR:sanh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107685560
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107685560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 107685560
NCBI-ProteinID: XP_016337670
LinkDB All DBs
Position
Unknown
AA seq 2628 aa AA seqDB search
MDALLNQELREDVKDCSIKVENFPKQVIFKGLAPRVVLTNHLLPKGTKAKVNLEEQGRQK
VSFSFAQTKKPRQNVFLAPPSPEKYASEHSSALQAGPVPTPDLAGQSDETKNVDTNTPAV
GETQTAPAPLSFPLKSKPVLGKMHFKKQILSVTVVEDNSIVSTASAEISEPVGPSESDKI
RYSAKVETETSLQQSHKNSVIDSSSEKVLKEENPQEKVDSCLKVPVSSHIGKGDKDTSII
SEHEENRKSQPRSDCTLPGSESDGDSIRTSSSQKSSDRRNKIKSECPSNEAKRSSNSKTE
ESEKSRHDRKEDEKGSSRSKSERDSRHTSSRSSRSDRDRRRTKSRSRSRSRGCRTSSYSR
SERSRSERQSRSDRSHYHDSERRFHRSSPHRERRGSRSRTDGRSRDSSDSEDDHRRTRTR
GSDSSRSSTYSSSQKDSKLSIHSRSHRDSKPTDCSRSSESDKRTQHSKSERSHLKAGDSE
SNRRSSPDAETVHRKSSAHSKSEINAKTSNSNPATSSRTSEEKVHKNSSDSDEEHRKKRQ
SQGSDRSSVSGTSSSKKTDSTDHKTLNNVTGTERQSKDRSSNNTKQSQLALSPVTPQKEC
SKIDDNSTLPKSKCISQRMHEATHKVNLFKTKQQTEQQAPNQELSSLGKCTNVPESHKTT
ERLKESTSTTSRSLEVRSSTDEPGMKNEIPIQSKALAEGPTDSFCVGHTPNQDSVGSLAD
PLSVKELPPGGCLKFNTKLDGPSHITQSAQLCEKDSEQHYVNPEQPSSGILKKDGSAKKS
RWDIVGQVTSEYQIVNPDVEKFILVKRIELNNDTTPEESCTQKQDSEVPSKKSVEEQIQD
TTSAESHQKVSSRASDLETQHTHGELIKQIVEDPQSTSAPVVSDLPLNCSSGSKEKINVD
KPKPETQDPDSLNHDGKWHSEDSESEESDSDSDDGRVSLKRLHSVVVVPKNSTIALETND
LTEPSPGCLVFSGQQQTDTHESINREFAYGFSNQSKLEESSAALFKASVQAAMLNPDIKH
VSYQSQSNMVDSTSHSEATIAHVYKNWSAQERPNSVQINQASLQSFEKTSRPQSDHHQNH
DRPDSWNGRKGGKQHYGESTDFNSGKGYGLAWDFNQSEQPSSTFQQPDSSHGTEHPPQPG
IALFDSGHRQGPWTQPAISKTNRPVNAHVPFQYHDSVNQIHPDSLTNDHDEDRVVGNKQG
SVLSADLPGSSPFVQAHEISSNCSFTTESQNISEAPREDNQKPHRGRGPPKKRRQEFESE
SDNEAEAGLSSKRECLDESSRVVKDGKESFHQIQEVVRPLLSLKNFVDPAVWREKAKQKK
MPPYFDLIEDNVYLTERKKNKSHRDIKRMQCECAILSREERAQGMMACGEDCLNRLLMIE
CSSRCLNGAYCSNRRFQMKQHADFEVILTETKGWGLRAAKDLQPNTFVLEYCGEVLDHRE
FKARVKEYARNKNIHYYFMALKNNEIIDATLKGNCSRFMNHSCEPNCETQKWTVNGQLRV
GFFTTKAVTAGAELTFDYQFQRYGKEAQKCFCGAPSCRGLIGGETRVSVRAAGGKKQRDR
SRKKDTDSALTTLDEELEALQENGEGLCGEKDVISLCRLMVRVETMEQRLTCLKLIQNTQ
NPLCLKQFLDHHGLSLLWIFMVELSEAKSNSVNNIKLQLEIMKALAVLPISTKNMLEESR
VLQFIQRWAQSRPLSQPAEQDGYSSESTSRAQTPLNTPDGPPAKLASELDGDTPKRAVYR
RLKIISENSLDSAMSDASKASDGKEEEEDEEEEEMEDETSQLEATIEREVKVENSEAPSE
SQAELEPELKQEPPETEEVTHSTPEDTGSEGETLETQEPEEKPIVKPEEQLEDEKIVEET
KSEEPSESQTESTTVEDAPSVTDTTSAADIINDVVAEVETPMAETQVENASSEQCSSEGN
ESCSTAEITPTQPSETIMESVSSESTAVAIESAPTESPSASVETTPPESVAVSTENISSE
AVVAAGSADATALAIVAVPAEGAAVGTPSQDEEEGVSDVESERSQEPQVQASDISDMAAR
LLDSWKDLKEVYRIPKKSQVEKESSDRSRDREALMTPRTPSSSRERERERDKERDRDRDR
DWERDRERDGERSSLRSADRKRRRGSTSPLPPSAYERGRRNDDRYEQSSSKKKLHTKESR
NKLSTEERRKLFEQEVAQREAQKQQQQQQQQQQQLQTLAFNPLAYTSSPNFMAYPPGYPI
QTYVDPTNPNAGKVLLPTPAVEPLCVTPAPGTFEQTPTQPIISELNLASPSSTTTQAGPA
SSLAHIPASLELSSGTQTQQFVQPAVPAQDPNMAVLSVPTQIASPQIQGQQGYTTLWDPN
TQQAVTVQTQPTQQYSTTAQPQTAIYYQGQPCQTIYSIPAGYPQTNTPVIQTYTEPAASY
LHGQQVYTGHQQGVVVQQGGTVTTIVTSQTVQQEMIVPNSIIDLPPPSPPKPKTIILPPS
WKVARDPEGRIYYYHIITRQTQWDPPSWDGTTDEASEEHEAEMDLGTPTYDENPSKFSTK
TAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCMLGRISNTEDFKHLARKLTHGV
MNKELKSCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYRPKEDIELD
NT seq 7887 nt NT seq  +upstreamnt  +downstreamnt
atggatgctctgttgaatcaagagctcagggaagatgtgaaagattgttcgatcaaggtt
gaaaacttcccgaagcaagtcatattcaaaggccttgcacctagggtcgtattgacaaac
catctcctgcctaaaggaaccaaggcgaaggtaaaccttgaggaacagggtcgacaaaag
gtctccttcagcttcgcacagacaaagaaaccacgtcaaaatgtatttctagccccacca
agtccggagaaatatgcaagtgaacattcttctgcactgcaagctggacctgtacctact
ccagatctagcaggacagagtgatgaaaccaagaatgtggatacaaatactccagcagtt
ggggagacccagacagcacccgccccattatccttccctctcaaatcaaaacctgttctt
ggaaagatgcattttaagaaacagattctcagcgttactgttgttgaggataactccatt
gtcagcaccgcctcagcagagatttcagagccagtaggcccatctgagtcagacaaaatt
agatattcagccaaggttgaaactgaaacctcattgcaacagtctcacaagaactctgtc
attgatagttcctctgaaaaagttctcaaagaggaaaaccctcaggagaaagtagactca
tgccttaaagttcctgtttcttcccatattgggaagggagataaggatacttccattatt
tctgagcatgaggaaaacagaaaatcacaacctcgatcagattgcacgcttccaggttca
gaatctgatggggattcaatcagaacatcatctagccagaagtctagtgaccgcagaaat
aagataaaatctgaatgtccgagtaacgaagcaaaaagatcctctaattccaaaactgag
gagtcagaaaaatccaggcatgataggaaagaagatgaaaaggggtcaagtcgttcaaaa
tctgagcgcgactctaggcacacatcgtcaagatcttctcgttctgacagagacagaaga
aggaccaaaagtcggtcacggtctagatctcgaggctgtcgaactagttcctattccagg
tctgaaagatccaggagtgagagacagtcaaggtcagataggtcacattaccatgattct
gagcggaggtttcatagaagttctcctcatcgtgaaaggagaggctcacgttcacgaacc
gatggcaggtctcgtgacagctctgactcagaggatgaccaccggcggacaaggactcga
ggtagtgactcaagtcgatcctccacttactctagctcgcaaaaagactcaaaattatcc
attcactccagatcccacagggactcaaaacccacagattgttctcgatcatcggagtca
gacaaaagaacccagcattcaaagtcagagcgatctcatttaaaagctggtgactctgaa
tccaatagaaggagctctcctgatgcagaaacagttcacaggaaatccagtgcccactca
aaatctgagattaatgctaaaacctcaaattctaacccagctacctcatcccgaacatct
gaggaaaaggtccataaaaacagctctgactctgatgaggagcacagaaaaaaacgtcag
tcacaaggatcagacaggtcatctgtgtctgggacttcatcttccaaaaaaacggactca
acggatcacaagactttaaataatgttactggaacagagagacaatcaaaagacagatca
agtaataacacaaagcagtcacagttagccctcagcccagttactcctcagaaggaatgc
agcaaaattgatgacaactctactctgcctaaatctaaatgcatttctcaacggatgcat
gaagctacgcacaaagttaatttgttcaaaacaaaacaacaaactgagcaacaagctcca
aaccaggaacttagtagtttgggaaagtgcacaaatgttcctgagagtcacaagacaact
gaaagattgaaggaatccacttccacgacaagtagaagtcttgaagttagaagttccact
gatgaacctggaatgaaaaatgagattccaatccaaagtaaagctctggcagaaggaccg
actgactcattttgtgtaggccacactcccaatcaggattcagtaggatcactggcagac
cctctttctgtgaaagaattaccacctggaggatgcttgaaatttaacactaaattagat
gggccatcgcacatcacacagagtgctcaactctgtgaaaaagattctgagcagcattat
gtgaatcctgaacaacccagtagtgggattttgaaaaaggatggtagtgctaaaaaatcc
cgatgggacattgttggtcaagtcacttcagaatatcaaatagtgaatccagatgtggaa
aagttcattttggtaaaaagaatagagttaaacaatgatactacccctgaagaatcttgt
acacagaaacaggactctgaagtaccatctaaaaaatctgtagaagaacaaatacaagac
acaacctcagctgaatctcatcagaaagtaagttctcgtgcgtctgaccttgaaacccaa
catactcatggtgaacttataaaacagatcgttgaagatcctcaatcaacaagtgcccct
gttgttagtgatcttccccttaattgcagttctggcagtaaagagaaaatcaatgtagac
aaacctaagcctgaaactcaagaccccgattccttaaaccacgatggtaaatggcacagt
gaggacagtgagagtgaagaatcggactcagattcagatgatgggcgtgtttctttaaag
cggttgcactcggtggtggttgtgccaaaaaattcaaccattgctcttgagacaaatgac
ttgactgaaccgtctcccgggtgcttagtgttttctggacagcaacagactgatacgcat
gaaagcattaatagggaatttgcttatggctttagcaatcagtcaaagcttgaggaatca
tcagctgcactttttaaggccagtgtacaagctgcaatgctaaatccagatattaaacat
gtctcctaccaatcgcagagcaacatggttgacagcaccagccattcggaggctaccatt
gcacatgtgtacaagaactggagtgcccaagaaagaccaaatagtgtccagataaaccaa
gcatcacttcagagttttgaaaagacttcgcgacctcaatcggatcaccatcaaaaccat
gatagaccagatagctggaatggtaggaaaggaggaaagcagcactatggggaatccact
gacttcaactctgggaagggttatggcttagcctgggactttaaccagtcagaacagccc
agcagcacatttcagcaaccggacagcagtcatggcactgaacaccctcctcaaccagga
attgctctgtttgatagcggtcacagacaaggtccatggactcagcctgccatctctaaa
accaacagaccagtaaacgcgcatgtgccttttcagtatcatgattcagttaaccagatc
catccagactctttgaccaatgatcacgatgaagacagggtagtagggaacaaacaagga
tctgtcctgtctgctgatcttccaggatcatccccatttgttcaagcccatgagataagc
agcaattgcagcttcaccacagaaagtcagaacatctcggaagcccctagagaagacaac
caaaagcctcatcgaggaaggggtccacctaagaagagacgtcaagagtttgaatctgaa
tcggataatgaggcagaggctggtctgagcagtaaaagggagtgtttggatgagagctca
agggttgtgaaagatggtaaggaatcttttcaccaaattcaagaggtggtgcgcccactg
ctcagtctgaaaaactttgtggatccagctgtttggagggaaaaggcaaagcagaaaaaa
atgccaccctactttgacctcattgaagataatgtatatctgacagaacgcaagaagaat
aagtcccatcgagacatcaagcgtatgcagtgtgagtgtgctatcctctcaagggaagag
cgtgcccaaggaatgatggcttgtggggaggattgcctcaaccgcttgctgatgattgag
tgctcttctcggtgtttaaatggggcatactgctccaacaggcgctttcaaatgaagcag
catgcagactttgaggtaattttgactgagaccaaaggctggggcctacgagcagccaaa
gacctacagccgaacacctttgttttagagtactgtggagaagttttggatcatcgggaa
tttaaggcacgggtgaaggagtatgcacgaaacaagaacattcactattatttcatggct
ttgaaaaataatgagattattgatgcgactttgaaaggaaactgttcccgtttcatgaat
cacagctgtgaacccaattgtgaaactcagaaatggactgtaaatggccaacttcgagtt
ggcttcttcaccaccaaagctgtgacggctggggcggaactcacttttgattatcagttc
caaagatatggtaaagaggcccagaagtgtttctgtggagctcctagctgtcgaggttta
ataggtggagagactcgggttagtgtccgagcagcaggtgggaagaaacagagggaccgc
tcacggaagaaagacactgacagtgcacttaccacgttggatgaagagctggaggctctg
caggagaatggagaaggcttgtgcggagagaaagatgtgatctcactctgcaggctcatg
gtgcgagtggagacaatggagcagcgactcacctgccttaaactcattcagaatacccag
aatcccttgtgcctgaagcagtttttggatcaccacggcctctcgctgctgtggatattt
atggttgaactttctgaggctaagagcaactctgtaaacaacattaaactacagctggag
ataatgaaggctctggcagtgcttcccatctcaacgaagaatatgctggaggagagccga
gtgttacagtttatccagcgctgggctcaaagccggccactcagccaaccagcagaacag
gatggctactccagtgagagcacctcacgtgcccaaacgcccctcaacacccctgatggt
ccaccagccaagctggcttctgagctggatggggacactcccaagcgagcagtctaccgt
aggttgaagatcatcagtgaaaacagtctggacagtgccatgtccgatgctagtaaagct
tcggatgggaaagaagaagaggaggatgaggaagaggaagagatggaggatgagacttca
cagttggaagccacaattgaaagggaggttaaagtagaaaacagtgaagcgccttctgag
agtcaagctgagcttgagcccgaattgaaacaggagccccctgaaactgaagaagtcaca
cattcaacaccagaggacactggcagtgagggagagacacttgaaacacaagaacctgaa
gaaaaacccatcgttaagcctgaagaacaactggaggatgaaaagatcgtggaggagacc
aagagcgaggagccatcagagtcccagacggagtcaacaacagttgaagatgccccttca
gtcacggacaccacatctgcagcggacattattaatgatgtagttgctgaagtggaaact
cccatggctgagacacaggtggaaaacgcatcttctgaacaatgcagctccgaagggaat
gaaagttgcagcactgcagaaatcacacccacacaaccatcggaaaccataatggagagc
gtatcctctgaatctacagctgttgccatagagagcgcacccacagaatctccgtctgcc
tctgtggaaaccactccacctgaatctgttgctgtttctactgaaaacatatcatcagag
gctgtcgtagctgccggttctgctgatgcgacggccctggctattgttgctgttccagca
gagggcgctgcagtggggacgccctctcaagatgaggaggaaggtgtctctgatgtggag
agcgagcgcagtcaggagccacaagttcaggcttctgatatcagtgacatggctgcccgg
ctgctggacagttggaaagacttaaaggaagtttacaggataccaaagaagagccaggtt
gaaaaagagtcaagtgatcgcagtcgtgatcgagaagccctgatgaccccccgcacacct
tcgagcagtcgagagagagagcgagaaagagataaggagcgcgatcgagaccgggacaga
gactgggagcgggaccgggagagggatggagagagatcgtctcttcgcagtgcagataga
aaaagacgacgaggctccacctcccctctaccgccttcagcctatgagaggggccgcaga
aatgatgaccgttatgagcagtccagcagcaagaagaaactccacaccaaagagtctcgt
aacaagctatctactgaggaacgacgaaagctctttgagcaggaagtggctcagcgggag
gcccagaaacaacaacagcagcaacaacaacagcagcagcaattacagactcttgcattt
aacccactggcctacacctccagtccaaacttcatggcctacccgcctggataccctatc
cagacctacgtggatcccaccaatcccaatgcaggaaaagtgcttttgcccacacctgct
gtagagcctctttgtgtcaccccagctcctggtacattcgaacaaacacctactcagcct
atcatatcagagctcaatctagcttcaccctcttccaccaccacccaggccggacctgcc
tccagcttggcacatatccctgcctctctggagctttcctctggcacacagactcagcag
tttgtccagcctgctgtgccggcacaggacccgaacatggccgtcctgtcggtgcctacg
caaatagccagcccacagatccagggtcagcagggttacaccacgctctgggaccccaac
acacagcaagcggtcacggtacagacgcagccaacccagcagtactccaccacggcacag
cctcagactgccatctactatcagggccagccctgccagaccatctatagcattcctgca
ggctacccacaaaccaacactcctgtcatacagacatacactgagccagctgccagttac
ctacatgggcagcaggtgtacacgggtcatcagcagggtgtggttgtgcagcagggaggc
acggtcaccaccatcgtcacatctcagacagttcaacaggaaatgatcgtacccaacagc
atcattgatctaccgcccccttcccctcccaaacctaaaaccattatcctgcctcccagt
tggaaagtggcgcgagacccagagggcagaatctattactaccacatcatcaccaggcaa
acacagtgggatcctcccagctgggatgggactacagatgaagccagtgaagaacacgag
gctgaaatggacctcgggacgcccacatatgatgaaaatccttcaaagttctctacaaag
accgccgaggcagacacgtccagtgagctggccaaaaaaagcaaagaagtcttccgcaag
gagatgtcacagtttattgtgcaatgccttaatccgtaccgcaagccagactgcatgctg
ggccgtatcagtaacacagaagacttcaaacatctcgctagaaagctgactcatggggtg
atgaacaaggaactgaagtcttgcaagaaccccgaagaccttgaatgcaatgagaacgtc
aaacacaagaccaaggagtacatcaagaagtacatgcagaagtttggcgctgtgtaccgg
cccaaggaagacatagagctggactaa

DBGET integrated database retrieval system