KEGG   Sinocyclocheilus anshuiensis: 107686820
Entry
107686820         CDS       T04917                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04068  FoxO signaling pathway
sanh04110  Cell cycle
sanh04115  p53 signaling pathway
sanh04218  Cellular senescence
sanh04310  Wnt signaling pathway
sanh04340  Hedgehog signaling pathway
sanh04371  Apelin signaling pathway
sanh04510  Focal adhesion
sanh04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107686820
   04340 Hedgehog signaling pathway
    107686820
   04371 Apelin signaling pathway
    107686820
   04068 FoxO signaling pathway
    107686820
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107686820
   04115 p53 signaling pathway
    107686820
   04218 Cellular senescence
    107686820
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107686820
   04530 Tight junction
    107686820
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107686820
NCBI-ProteinID: XP_016339433
UniProt: A0A671QIJ9
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLFCCEVDTIRRAYQDSNLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIAPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTKKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVRPSELLQMELLALNKLKWDLASVTPHDFIEHFLAKLPIHQSSKQILRK
HAQTFVALCATDVNFIASPPSMIAAGSVAAAVQGLYLKSSDSCLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHNISTETKRVEEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacaccagttgttttgctgtgaagtggataccattagaagagcttaccaagatagc
aacctgttgaatgaccgagttttacagacaatgctcaaagcagaggaaaactatcttcca
tcaccaaattatttcaagtgtgttcagaaagaaatcgcacctaaaatgaggaaaatcgtc
gccacatggatgctcgaggtctgtgaagaacagaaatgcgaagaggaagtttttccgttg
gctatgaactacctggaccgatttttatctgtggagcccaccaaaaagaccaggttacag
ctgttaggtgcaacttgtatgtttttggcctctaagatgaaagagactgtgccactaaca
gcagagaagttgtgcatatacacggacaactccgtccgtcccagcgaattattgcaaatg
gaactgctggcactaaataaactgaagtgggatcttgcctcagtcacaccacatgatttc
attgaacacttcctcgccaaactgcctatacaccagagctccaagcagatactgcgcaag
cacgcccagacgtttgtggccctctgtgcaacagatgttaacttcatcgcaagccctcca
tccatgatcgcggccggcagcgttgctgcagcagtgcaggggttgtacctgaaaagcagt
gacagttgcctctcatcccagaacctcaccaacttcctctcacaagtcatcagaagcgac
cctgactgtctgcgatcgtgtcaggaacagatcgagtccctgctggaatctagtctcaga
caagctcagcagcacaacatctccacagagaccaaaagagtggaggaggacgtggacctc
tcttgcactcccacagacgtcagagacattaatatctga

DBGET integrated database retrieval system