KEGG   Sinocyclocheilus anshuiensis: 107687195Help
Entry
107687195         CDS       T04917                                 

Definition
(RefSeq) MARVEL domain-containing protein 3-like
  KO
K21099  MARVEL domain-containing protein 3
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107687195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sanh02000]
    107687195
Transporters [BR:sanh02000]
 Other transporters
  Pores ion channels [TC:1]
   107687195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MARVEL EVI2A
Motif
Other DBs
NCBI-GeneID: 107687195
NCBI-ProteinID: XP_016339912
LinkDB All DBs
Position
Unknown
AA seq 295 aa AA seqDB search
MSQPSRNHRPQRERNGGHYSERRDREPRSRRDNPSERSGSERSSGQPPYYPRGSQRHARS
APREHRESKCSYVCSRRGIVLICAVLTNALVLICVVAAHMSQLGMSAMGMGGTSFIDAII
PFEGVELQQVRELDMQYGQMRAPGVYGGVAFSLTFGALSLLFIVSSSKPPHMLPRKLLIG
QFAFQIIGAVAYVVAVGLYLHFVVSVNSTEVCVRRERLYARNGYTWMNCSVNGGDAAVAL
FGIITAILYAVGTFLTGKTIQDVNRYLKERERFEAEHREQPRGPLKTPLDPDNYV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccgtccagaaaccatcgtccgcagagagagagaaatgggggacactatagt
gagaggcgagaccgagagccccgcagccgtcgagacaatcctagtgagcgatcaggcagt
gagaggtcgtctggccagccgccatactaccccagaggttctcagagacatgcgaggagc
gctcctcgagagcaccgggagtcaaagtgctcttacgtctgttccaggagaggtattgtg
ttaatatgcgccgtcctgaccaatgcgttggtgctcatctgcgtggtggccgctcacatg
tcacagctgggcatgtctgcgatgggtatgggcggaacgagcttcattgacgccatcatt
ccttttgagggggtggagctgcagcaggtgcgtgagcttgacatgcagtacggacagatg
agagcaccaggagtctatggcggtgtggccttcagcctcacctttggtgcactttcactc
ctattcatagtgtccagcagcaaacccccccacatgcttccacggaagctcctgattgga
cagtttgcattccagatcattggtgcagtggcttacgtggttgcggtaggtttgtatctg
cacttcgtggtctcggtgaactcaactgaggtgtgcgttcggcgtgaacgactgtatgct
cgtaatggatatacctggatgaactgtagtgtgaatgggggggatgcagctgtcgcattg
tttggaattataaccgcaattctgtatgctgttgggacctttttaacgggaaaaacaatc
caggatgtcaatcgttacttaaaggagcgtgagcgctttgaagccgaacacagagaacaa
cccagaggtcctctgaaaacacctcttgatcctgacaattatgtctga

DBGET integrated database retrieval system