KEGG   Sinocyclocheilus anshuiensis: 107687769Help
Entry
107687769         CDS       T04917                                 

Definition
(RefSeq) sucrase-isomaltase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00052  Galactose metabolism
sanh00500  Starch and sucrose metabolism
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107687769
   00500 Starch and sucrose metabolism
    107687769
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     107687769
    3.2.1.20  alpha-glucosidase
     107687769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 107687769
NCBI-ProteinID: XP_016340711
LinkDB All DBs
Position
Unknown
AA seq 1810 aa AA seqDB search
MGKRCFSGLEETLMVLFALVTLLHTGEPRTIRDDSVSVQNVAPECPSIPYGERVDCFPHP
DASEQKCLERACCWSPVDEANVPWCFFSKNHGYSVVSESQPDSTHIEARLTRMDAPSLFG
ADIKELIFYAEMQTENRLRFKITDANQARFEVPHEHVQAPSSPPTGPLKYRLELIQKPFG
LKVWRTSPEKLLFDTTIGPLVFADQYLQLSAKLPSHNIYGLGEHVHQTFRHDTNWRTWPI
FTRDSFPNGGTHNLYGHYPYFTCLENESGQSFGVFLMNSNAMEVTIQPAAITYRTIGGVL
DFYILVGDTPEAVVDEFTQLIGRPFIPPYWSLGFQLSRWDYGSLDELKKVVERNRQIGIP
YDVQYTDIDYMEDKKIFTYDMEKFKELPQFADYMHENGQKYIVILDPAVSTGKRLNGPYE
ALDRGHAAKVWVTEPDGNTPLIGEVWPGETVFPDYTNQACVDWWVDEISRFHKEVKHDAL
WIDMNEVANFVQGSSKGCAENKLNYPPFTPRILDNLMYSKTLCMDAKHKWGNHYDVHSLY
GYSMVLATEKASREVFKTNRSMVFTRSSFPGVGKYAGHWLGDNAANWNDIKWAIPGMLEF
NLFGVPYIGADICGFFDDSPEELCRRWMQVGAFYPFSRNHNAQGYKDQDPAAYGADSLLV
KTSKHYLNIRYTLLPYLYTLFYKAHVNGETVLRPMMHEFYSDSETWGVHNQFLWGAHLLI
TPVLDPGVENVEAYIPDAIWYDFEKEEQITDRKEKVNLNLPADKLGLHLRGGAILPAQRP
DITTTYSRRHPMRLIIALDDNNAASGELFWDDGESRDTVSSGSYIHYQFSVANDVLTMHV
THNGYTDPNNLKFENITVMGVTGAPVSVLVSDGTTTNALTESQVNYDSTRKVLYLRNLEL
ELGKNYTVNWQDKYRNSRHFDCYPEAGSDQAKCEARGCIWEPSNVPNEPWCYYPDTHGYI
TSNVVETASGITVDLERNTAFPSQRSQSRDISKLRVEITYLSGKSLRWKIFDPSNARYEV
PLPLDLPAMPETEENNRLYRVQINNKPFGIQVIRKDTEEIIWDSAVPGLTFSDQLLEIST
LLPSNYVYGFGETEHPIYKHDLNYHKYGLFTKDQPPGHKLNSYGVHPFYMGLEKSKYAHG
VLLLNSNAMDVTFLPTPALTYRTVGGILDFYMVMGPTPEAVVQQYTEMIGRPVLPAYWSL
GFQLCRYGYSNDAEIADLYRDMKAAKIPYDVQYADIDYMERQMDFTLDKVNFKGLPALVD
NMRAEGMRFIFILDPAIAANETKGSYPAFDTGFETDIFIKWPPELSNDIVWGKVWPDYPN
ITVDNSLDWDTQVELFRAFVAFPDFFKSSTAEWWAQQIKDFYNNVMKFDGLWIDMNEPAS
FVHGTVGEKCLGDPALENPPYMPPLESMHRGLNHKTLCMNSEQILADGTRVKHYDVHNLY
GWSHTKPTYDALLSATEKRGVVVTRSTYPSSGRWAGHWLGDNYSAWDQLLKSIIGMMEFS
IFGIPYTGADICGFFNPAQYEMCLRWMQLGAFYPFSRNHNTINMPRQDPVAWGPEFAAIS
RDVLNIRYTLLPYLNTLMYEAHAHGNTVVRPLLHEFVSDENTWSIDRQFLWGPALLITAA
LDPGVSVVRGYVPNARWYDYHTGEVVGVRGQFMNMDTPLSKINLHVRGGHILPWQKPENN
THYSRLNPLGLLVALDDGGSAHGSLFWDDGEGIDTVQNKRFLLTSFSVSSGVLTNAVLTD
GLAEADRLTLGVVKVWGVSAPVTQVIMKVTGKPDAKLEFTYNAEVQELQFDATSQSHTIE
KPFTITWSTA
NT seq 5433 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagcggtgcttctcagggttggaggagaccctgatggtgttgtttgcattggtc
actttactgcacactggagaaccaagaacaatcagagacgattcagtatcagttcaaaac
gttgctccagaatgtcccagcattccatacggcgagagagtggactgcttcccacatccc
gacgcttccgagcaaaaatgcttggaaagagcttgctgctggagccctgtggatgaggct
aacgtcccctggtgcttcttctccaaaaaccacggctacagcgtggtcagcgaaagccag
cctgacagcacacatattgaggccaggctgacaagaatggatgctccatctctatttgga
gctgacattaaagagttgatcttctacgctgaaatgcagactgaaaaccgtcttcgattt
aagatcacagatgcaaaccaagccaggtttgaggttcctcacgagcatgtgcaagcgcct
tccagccctcccaccggacccctcaaatatagactggagctgatccagaaaccctttgga
ctgaaagtttggagaacatctcctgaaaaactcctgtttgacacaaccattgggccgctg
gtttttgcggatcagtaccttcaactctcggctaaactcccctctcacaatatttatgga
ctcggagaacacgtccatcagaccttccgccatgacaccaactggaggacctggcctatc
ttcacaagagattcttttcccaatggcggcacacacaacctgtacggccactacccctat
ttcacatgtcttgaaaatgagagcggccagtcctttggtgttttcctcatgaacagcaat
gctatggaggtgacaatccagcctgctgccataacctaccggactatcggaggggttttg
gacttctacatcctggttggagacacaccagaagcagtggtggacgagttcacacagctg
attggcaggcctttcattcctccgtactggtctctgggtttccagctctctcgctgggac
tacggcagcctggacgagctgaagaaagtcgtggagaggaaccgacagatcggcattccg
tatgatgtccagtacactgatatcgactacatggaggacaaaaagatcttcacctatgat
atggagaaatttaaggagctgcctcagtttgctgactacatgcacgagaatgggcagaaa
tacatcgtcatattggatcctgctgtgtccacaggtaaaaggctaaatggaccatatgaa
gcacttgatcggggacatgcagctaaagtttgggtcactgaaccagatgggaacacgcct
ctaataggagaggtctggccaggggaaaccgtgtttcctgactacactaaccaggcttgc
gttgattggtgggttgatgaaatttcacgtttccacaaagaagtcaagcatgatgctctc
tggattgacatgaatgaggtggccaatttcgtacagggaagcagcaaaggctgcgctgag
aacaaactcaactatcctccattcactccacgtatccttgataacctgatgtacagtaag
accttatgtatggatgctaaacacaaatgggggaaccactatgatgtccacagtctctat
gggtactcgatggtcctggccactgagaaggcatcgagagaagtgtttaagacaaaccgt
tccatggtttttacccgttcctccttccctggggtgggcaagtacgctgggcactggttg
ggtgacaatgccgccaactggaatgacattaagtgggcgatacccggcatgctggagttt
aacctctttggagtcccttacattggcgcagacatctgtgggttcttcgacgactcgccg
gaggagctttgcagacgttggatgcaagtcggcgcgttctaccccttcagccgtaaccac
aacgcacaagggtacaaggaccaggaccctgcagcatatggcgccgactctctcttggtg
aaaacctccaagcattacctgaacatccgatacaccctcttgccgtacctctacactctc
ttctacaaggcccacgtcaacggagagactgtattgcgtcccatgatgcacgagttctat
tccgacagtgaaacctggggagtgcacaaccagttcttgtggggagcacatcttctcatc
acacctgtgttggatcctggtgttgaaaatgtggaggcctacattccagatgccatctgg
tatgactttgagaaggaggaacagattaccgatcgcaaagaaaaagttaacttgaacctg
cctgctgataaacttggtttacacctgagaggtggagccattctgcccgcacaaaggcca
gacatcaccactacatacagccgacgtcatcccatgagactgatcatcgctctcgatgac
aacaatgctgcatcaggagagctattttgggatgacggagagtctcgagatactgtttca
tccggctcctacattcattaccagttttccgtggctaatgatgtcttgacaatgcatgtc
acccacaatggctacacagatccaaacaacttgaagtttgagaacatcactgtaatggga
gtgaccggagctccagtctctgtgctcgtgtcagacggcaccactactaatgctctgacc
gagtcccaggttaactacgattctacccggaaggtgttgtacctgagaaacctggagctg
gaactggggaagaactacacagtcaactggcaggacaaatacagaaactctaggcacttc
gattgttatcctgaagcaggttccgatcaggccaaatgtgaagcccgtggctgcatctgg
gagccttcaaatgttcccaacgagccctggtgttattaccctgacacccacggctacatc
accagcaacgtggttgaaacggcgagtggcatcactgtagatttagagcgcaatacagct
ttcccaagtcagcgttctcaatctcgagacatcagcaagctccgtgtggaaatcacatac
ctgagtggcaaaagcttgcgttggaagatctttgacccaagcaatgcacgctacgaggtc
ccccttcccctcgacctgcccgccatgccagagacagaggaaaacaacagactgtacagg
gttcagatcaataacaagcctttcgggatccaagtcatcagaaaggacacagaagaaatc
atatgggactctgccgtgccagggctcacattctccgatcagctccttgagatctccacg
ctcctgccctcaaactacgtctatggttttggtgaaacagagcaccccatctacaaacat
gacctcaactatcacaaatacggcctgtttaccaaagaccagcctccagggcataagctg
aacagttatggagtccatcccttctacatgggtctggagaaatcaaaatatgctcacggc
gtcctcctgctcaacagcaatgccatggatgtgaccttcttgcctactccagctctgacc
taccgcaccgtcggaggcatcttggacttctacatggtgatgggacccactccagaagct
gtggttcagcagtacactgagatgatcggccgcccggttcttccagcctattggtcgctt
ggattccagctttgtcgttacggctactccaacgatgcagagatcgcagatctttacaga
gacatgaaagctgctaaaattccttatgatgttcaatatgcagacattgactatatggag
aggcagatggactttacgctggacaaagtgaacttcaagggactgcctgctctggtggac
aacatgagggctgaggggatgcgcttcatcttcatattggacccggctatagcagccaat
gagacaaaaggctcctaccctgcatttgataccgggtttgaaacagacattttcatcaaa
tggcctcccgagctcagcaatgacattgtgtggggaaaggtgtggcctgattatcccaat
attactgtggacaattctttggactgggatactcaagtagagctattcagagctttcgtg
gcgttccctgatttcttcaagagcagtacagcagaatggtgggcacagcagattaaagac
ttttacaacaacgtcatgaagtttgatggactttggatcgacatgaatgagccggccagt
ttcgtgcatggcaccgtcggagagaaatgcctaggggatcccgctttggaaaaccctcca
tacatgccccctctggagtccatgcacagaggcctgaaccataagactttatgcatgaac
agcgagcagatcctggctgatggcacacgcgtcaagcattatgatgtccacaacttatat
ggctggtctcacacgaaacctacttatgatgctttgcttagtgccactgaaaagagaggt
gtcgtagttacccgttcaacatatccatctagtggtcgctgggcaggacattggctggga
gacaactactccgcctgggaccagcttctcaagtccatcataggcatgatggagttcagc
atatttggcatcccttacaccggtgctgatatctgtggcttctttaaccctgcccaatac
gagatgtgcctgcgttggatgcagcttggagctttctacccgttctccagaaaccacaac
accataaacatgccaaggcaggatcccgtggcctggggaccggagtttgctgctatctct
cgtgatgtgctgaatattcgctacaccctcctgccgtatttgaacacactgatgtacgaa
gctcacgctcacggaaacactgtggtcagacctctgcttcatgagtttgtgtcagatgaa
aacacatggagcatcgacaggcagttcctctggggtcccgcgcttctcatcacagctgct
ttagacccgggcgtgagtgtggtcaggggctacgtgccaaacgcccgctggtacgactac
cacacgggtgaagttgttggagtgcgaggacagttcatgaatatggatacaccgttatcg
aaaattaacctgcacgtgagaggaggccacatcctgccctggcagaaaccagagaacaac
acacactacagtcgcctgaatcctctgggtcttcttgttgctcttgatgatggaggttca
gcacatggatccttgttctgggatgacggagagggaattgatactgttcagaacaagcgt
ttcctcttgacgtctttctctgtgtcttcgggtgttcttaccaacgcagttctcacagat
ggtctggccgaggccgacaggttgaccctgggtgtcgtgaaggtgtggggtgtgtcagcg
cccgtcactcaagttatcatgaaagtgactggaaagcccgatgccaaattggaattcacg
tataacgctgaggttcaggagctgcagtttgatgcaacatcacagtctcacaccatcgag
aagcctttcaccatcacctggagcacagcttag

DBGET integrated database retrieval system