KEGG   Sinocyclocheilus anshuiensis: 107689149Help
Entry
107689149         CDS       T04917                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD1B-A-like isoform X1
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sanh00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107689149
Enzymes [BR:sanh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107689149
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107689149
   HMT complexes
    COMPASS/SET1 complex
     107689149
    COMPASS/SET1 complex (yeast)
     107689149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 107689149
NCBI-ProteinID: XP_016342552
LinkDB All DBs
Position
Unknown
AA seq 1848 aa AA seqDB search
MSRPGERNKLNEDHGRRQSSSLANGMENSHPICSSGEKRSHHWRSYKLIIDPALKKGSHK
LYRYDGQSFSVPNPGMPPVDIVRDPRIGRMWTKYKETDLPVPKFKIDECYIGRVPPKEVT
FAKLNDNVREGFLLDMCKKFGDIEEVDILYNPKNKKHLGIAKVVFGTVKAAKDAVQNLHN
TSVMGNIIHVELDPKGEHRQRYFQRLINGSYTPLTLPVGGEEACEVSPRSLAEALLPLRR
LSEGSSSAVGGTATPGGTNTPMSLDTAYSSLRQDTPQSQGTPHTPRPSGTPFSQDSSYSS
RQGTPAFQSNRAESSGGYKSRRHETKFQDAYNRRPERHYVHGTGGGAHRGNAEQPPSFKQ
HQPPEPPSPAFAHTPPPPASANFKNAFSPYQPPMPPVYPHTEPSFHQPVQREVDYRRPPQ
APPPPSTDFMPVRDGPATPPIPEPPPPAPEAQPATPPPSTPETCLSLGTPTQDSERNSLD
SRIEMLLKPFLNERGDSDAEVRMDGSPISSSSSQLSPIPPQRPSRPASTGLEDISPTPLP
DSDDDEPIHGTASLLTNSRSMSPSNMHSKSGAGEPQTPVDKMDTGHQSSGEDMEISDDEM
PGTPIASGDCAKNIVVNSAMSPMQTIPMPPPGFPPLPHPQAGFPLPLHPLPTVPHLAGPH
PMLHPLHPYPPGMMPIMQMDLMSSLPQWGSVHMSFQMQTQMLSRMAQSQRPYPYPHFISG
AAASAGAAAAAAMQFGGPYPPLSMVGAPAGTVGHGQPWPLPNMPKFNPAVPPPGYEPQKE
DPHKATVDGVLMVIVKELKAIMKRDLNRKMVEVVAFRAFDEWWDKQERSAKATLTPVKTG
EGKDEEKERAKPKETISSSLLENWTKVEGLGFEGMGLSIGLRGAIRLPSFKVKRKQPPEP
TSTNDNKRVRPSTPVDDELEDEESERTDLRTDGSRTDGGGSSAKRRPARPLELDSEGEEE
EETSGKEESSLSDHEEEPVENASERLSSSMDIEDKEDDEKKSESDSSESESSDSSDDESS
SSSSSSKSDSDSSGSESSSDYESSSGEEEEEEEEQAVAMEDEDEDDAQTSSTSSSSSSSS
SEAEDVDIKAPSTPTGPPPEEEPNELGRLEALDEAEIDHKHTAVSSIKPGVEDVWPPSPK
GLPADEPDIDLAVSIPVPKAEATLEDVSSLRPPTPTGSFADTDQDTRPKIPAEDFPRTPG
RDGPVPLESEAAIPRSLPMPSMHLPLPPSHALKARSLLPPPEALPDMPVRGRLPTEEDIP
RTPGRDLMDRPRGLGKSQSTDTVPGTPGSDTPLTGNSLSSPHIPGSPFSYPAQSPVLSAG
IPRTPGRDLTFTPAFPDSAALSAGLPMHRKASSESLEEKSLFKEPLLSASPQASLQPNNA
VSSPFPGPPLPAASLQEPPLPPQGSSPTSAETSSPAAPKDLPVPMIDVPVPLDTTPSKRK
PGRPKSKKVPVDTPPDSEEPPAPMVASTPPDLPVNDLYPDHPSDTFKREDGDSTALEEEE
NQTQTVIPEVEDRLSYVEEPVQKTRRQRRGWQELLLSMHSPVTSPLRPSFLPRSDFEEMT
ILYDIWNDGIDEEDIRYLKITYDKMLQQDNGNDWLNDTLWVHHPPTNMGSTSGLKKKRKE
DGIRDHVTGCARSEGYYKIDKKDKMKYLNSSRLQSEEPDVDTQGKSIPAQPQASTRAGSE
RRSEQRRLLSSFSCDSDLLKFNQLKFRKKKIRFCKSHIHDWGLFAMEPIAADEMVIEYVG
QNIRQVIADMREKRYEEKGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVIT
VESQKKIVIYSRQPINVNEEITYDYKFPIEDEKIPCLCGAENCRGTLN
NT seq 5547 nt NT seq  +upstreamnt  +downstreamnt
atgtccagacctggagaaagaaataagctaaatgaagatcacggtagaagacagagttca
agtttggcgaacggaatggagaacagccatcctatctgcagttcgggagagaaacgaagt
catcattggagaagttacaagttgattattgacccagcgttgaaaaagggatcgcacaaa
ctgtatcgctacgatggacagagcttcagcgtgccgaaccccggcatgccaccagtggac
atcgtccgagacccgagaatcggtcgtatgtggactaagtacaaggagactgatctcccg
gttcctaaatttaagatcgatgagtgttacatcggtcgcgtgcccccgaaggaggtcacg
ttcgccaagctcaacgacaacgtcagagagggattcctcctcgacatgtgcaagaagttc
ggcgatattgaggaggtggacattttgtacaatccgaagaacaaaaaacatctcggaatt
gctaaagttgtattcgggaccgtcaaggcggcgaaggatgctgtccagaacttgcacaac
acgtctgtcatgggcaacatcatccacgtggagttggaccctaaaggtgaacatcgccaa
aggtacttccagcgtctgatcaatggaagttatactccgctcactcttccagttggtggt
gaagaggcctgtgaagtttctccacgcagcttggctgaagccctgctgcccttgcgaaga
ctgtccgaaggcagttcttctgcagtcggaggcacggccacgccaggcggcaccaacacc
cccatgtccctggatacggcctactccagcctaaggcaggatacgccacagtcccagggt
accccacacaccccgcgcccatcgggcaccccgttctctcaggactccagctattccagc
aggcagggcactccggcgttccagtcgaaccgtgctgaatcttcgggaggctacaagtcg
agacggcatgaaaccaaattccaggatgcctacaaccgaagaccggagaggcactacgtc
cacggtacaggaggaggggcacatcgtggcaatgcagagcaaccgcccagttttaagcaa
catcagccccccgagccaccgtcgcctgcttttgcgcacacgccgccgccaccagccagt
gcaaatttcaagaatgctttctctccttatcagcccccaatgcccccagtgtaccctcac
acagagccctccttccaccagcctgttcagcgggaagtggattataggagaccgcctcaa
gccccgccacccccgagcaccgacttcatgcccgtcagagacgggcccgcaacgccacca
atccccgagccgcccccccctgctccagaagcccaaccagccacgcctcccccctccacg
ccggagacctgcctgtcgctgggcaccccgacccaggactccgagcgcaacagcttggac
tcgcgcatagaaatgcttctgaagcccttcctgaacgagcgtggagactcggacgcagag
gttcgcatggacggcagtccgatctcctcctcgtcttctcagctctcccctattccaccc
cagcggccctcgcggcctgcaagcaccggcctggaggacatcagcccaacgccgcttcct
gattcggacgatgatgaacctattcatggtactgcttccctgctgacaaactctaggtcc
atgtcaccctccaacatgcacagtaaaagcggtgcgggagaaccacagacgcccgttgac
aaaatggacacgggccatcagtcgtcaggtgaagacatggagatttccgatgatgagatg
cctggcacaccgatcgctagcggggactgtgccaaaaacattgtggtcaactctgcgatg
tctccgatgcagaccattcccatgcccccgccagggttccccccactgccccatccacag
gctggcttcccactgccgctgcatcctcttccaactgtaccacacctggctggcccccat
ccgatgctacacccattgcacccttatccccctggcatgatgcccattatgcagatggac
ctgatgagctccttaccacagtggggcagcgttcacatgtccttccagatgcaaactcag
atgttaagtcgcatggcgcagagccagcggccgtacccttaccctcacttcatcagcggg
gctgctgcaagtgctggtgctgctgccgccgcagccatgcagtttggcggcccgtatccg
cctctgtctatggttggtgcacctgcaggcactgtgggtcacgggcaaccctggccccta
cccaacatgcccaagttcaaccctgctgttccccctccaggctatgagccccaaaaggaa
gacccacacaaagccactgtggatggagttcttatggttatcgtcaaggagctgaaggcc
atcatgaaaagagatctcaaccgaaagatggtggaggtggtggctttcagggcatttgat
gagtggtgggacaaacaggagcgttcggctaaggctacgcttacacctgtgaagacaggt
gagggcaaagatgaggaaaaagaacgggccaaacccaaagagactatatcctctagctta
ctggaaaactggaccaaggtggagggtctgggcttcgagggaatgggactcagcataggc
ctgcgcggtgccatccgattaccatccttcaaggttaagaggaaacagccccctgagcca
acgtctaccaatgacaataagagggtgcgaccatccacacctgtcgatgatgagctggaa
gatgaagagtcagaaagaacagatcttcgcacagacggttccagaacagatggtggtggt
tcttctgccaagcgaagaccagccagacctctggagctggacagcgaaggcgaggaggag
gaggaaacctctggcaaagaggaatcatcgctttcagaccatgaagaggagccagtggaa
aatgcctctgagaggttgtcctctagcatggatatagaggacaaggaagatgatgaaaag
aaaagcgaatcagactccagtgagagtgaatcatcggactcatcggatgacgaatcttct
agctcatcttcctcttccaaatctgattccgattcttctgggagcgagagctcgtctgac
tacgaatcaagttcaggggaggaagaggaggaagaagaagagcaggcagtggcaatggag
gatgaagatgaagacgatgcacaaacctcatcgacgtcctcatcttcctcatcctcgtct
tctgaagcggaggatgttgacataaaagctcctagtacccccacaggaccaccaccagaa
gaggaaccaaatgagttgggcaggctggaagcgttagatgaggcagaaatcgatcacaaa
catactgcagtgagctcaatcaagcctggagttgaagacgtgtggcctccatctcccaaa
ggattgccagctgatgaacccgatattgatttggcggtcagtattccagtgcccaaagct
gaagccaccctggaggatgttagtagcttgcggccacccaccccaacaggttcgtttgca
gacactgatcaggacacccgaccaaagatccctgccgaagactttccccgtacccccggt
cgtgatggcccggttcccctagaatcagaggctgcaatccctcgttctcttcctatgccc
tcaatgcaccttccacttccccccagtcatgcccttaaagctcgatcccttctgccgcct
cccgaagctttgccggatatgcctgtccgtgggcggttgcctacggaagaggacatccca
cgcacaccggggagagatcttatggacagaccccggggtttgggcaagtctcaaagcact
gatacggttcctggcacaccaggtagcgacacgccgctaacaggtaacagcttgagctcg
ccacatattcccggcagccctttctcttaccccgctcaatcccctgtcctcagcgctggt
atccctcggactccgggtagagatcttactttcaccccagctttccccgactctgctgct
ttatctgcaggccttcccatgcacaggaaggcctcgtctgagagcttggaggagaagtct
ctctttaaagagcctctactcagcgcctctccccaggccagcctacagcctaacaatgca
gtttcttccccattccctggtcctccccttcctgctgcttcacttcaggaaccaccgctg
cctccccaaggctcctctcccacttctgctgagacttcctctcctgctgctccaaaagac
cttcctgttccaatgatagatgttcctgtgcccttagatactactccaagcaagaggaaa
ccgggacgccccaagtctaaaaaggtacctgtggacacccctccagattctgaagagcct
ccagctccaatggtggcctcaacacctccagatctaccagtaaatgatctgtacccagac
cacccttcagacaccttcaaaagagaagatggtgactccacagcattggaggaagaggaa
aaccaaacccagactgtcatacccgaggtggaagacaggttgtcttacgttgaggaacct
gttcagaagacgcgcagacaaaggcggggctggcaagagttgttgttgtccatgcactcc
cctgtgacatcaccgctccgccccagcttcctaccccgctcagattttgaggagatgact
atcttgtatgacatctggaatgacggcattgatgaggaggacatccgctaccttaagata
acttacgacaagatgctgcagcaggacaatggcaacgactggctcaacgacaccctctgg
gtccaccatcctcctaccaacatgggcagcacatcagggctgaagaagaagcggaaagag
gatggtatacgcgaccatgtcaccggctgtgcccgcagcgagggctactacaaaatcgac
aagaaagacaaaatgaagtacctaaatagctcacgcctgcagtccgaagagcctgatgtg
gacactcaggggaagagtattccagctcagccccaagcgtccactagggcaggttcagag
cggcggtctgaacagcgccgcctgctgtcgtccttcagctgcgacagtgacctcctcaaa
ttcaaccagctcaagttccgtaaaaagaagatccggttctgtaaaagtcacattcatgac
tggggattgttcgccatggaacctattgctgctgatgagatggtaatcgaatatgtcggc
cagaatatccgacaggttatcgcagacatgcgagagaagcgctacgaggaaaagggcatc
ggcagtagctacatgttccgtgtggatcacgataccattatagacgcaaccaaatgtggc
aacttcgcccgcttcatcaatcacagttgcaatccaaactgttatgccaaggtcatcact
gtggaatcgcagaaaaagatcgtcatctactcccggcagccaataaatgttaatgaggag
atcacctacgactacaagttccccatcgaggacgaaaagataccgtgcctctgtggcgca
gagaactgcaggggaaccttaaactaa

DBGET integrated database retrieval system