KEGG   Sinocyclocheilus anshuiensis: 107689374Help
Entry
107689374         CDS       T04917                                 

Definition
(RefSeq) DNA ligase 3-like
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh03410  Base excision repair
Module
sanh_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:sanh00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    107689374
Enzymes [BR:sanh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107689374
DNA repair and recombination proteins [BR:sanh03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     107689374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 107689374
NCBI-ProteinID: XP_016342819
LinkDB All DBs
Position
Unknown
AA seq 1011 aa AA seqDB search
MPSLWLGRAVRTLSRSSVPKLCKETSFRATLNHQSLQCSRTLIFSWGFVSSPSGIVFCVP
QIRQFSLSSGSYFHVSWPEWRSERPVMAEQRYCVEYAKRGTAGCKKCKDKIMKGLVRIGK
IVPNPFSESAGEMKAWYHVKCIFEKLERARATTKKIDDITELEGWEELQDEDKELINKHV
SELAGKANASPKKKVQAKLNNSGQLSAPLADPTVNAPRKFSGFTANKAGSSSSSPGPSSA
KPTQGSSLSAHLCDPNHKDCLLREFRKLCALVAEKSSYNAKTEIIRDFLTKGSGGDKFCG
DLYLTVKLLLPGVVKNVYNLSDKQIVKLFSRILNCSQDEMVQDLEQGDVSETVRIFFEQS
KSFPLAAKSLLTIQEVDASLSRLSQLTKEDDQQAELQDIAKKCTGNDLKCYIRLVKHDLK
INSGAKHVLDAVDPNAYYAFKASRNLGDVIYRVLRNQQDTFNGTGPRKILSVEASLMTPV
QPMLAEACKSIEYAMKKCPNGMYSEIKYDGERVQVHKNGNHFSYFSRSLKPVLPHKVAHF
KDFIPQAFPGGHSMILDAEVLLIDTKTSKPLPFGTLGVHKKAAFQDAQVGLFVFDCIYFN
GVSLMDKPLCERRKFLLDNMVEVPNRILFSEMKHVTRAADLAEMITRVIREGLEGLVLKD
IKGHYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGKGSNGGIMSSFLMGCYDPESK
KWCTVTKCSGGYDDTTLARLQKELDVIKIGKDPSKIPGWLKIVKSYYPDFIIRDPEKAPV
WEITGAEFSKSEMHTADGISIRFPRCTRMRDDKDWKTATNLQQLKELYRISKENCDFEVT
AGPSKTSQNDKSSSGGESGGSSPSISHGASTANKTKNGHTPKAKAVKTESSSPAVKRKLP
TEKQDAKKIKTEPVYSNGQSKLQTVQTTDTKNEKTLLDIFTGVKLYLPESVQDFEQLRRY
FLAYDGDLVHEYDSVSATHTLGEPEDDSPAQRVTSNWIWECIRKRRVVPPS
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtctttggcttggcagggcagtgaggacactcagcagatcatctgtgccaaaa
ctttgtaaggaaacttcattcagagcaacactaaatcatcagtcgctccagtgctcgagg
actcttatattttcgtggggctttgtgtctagccccagtggcatcgttttctgtgtgcca
caaattcgacagtttagtctcagctccggctcttatttccacgtttcttggcctgagtgg
cgaagtgaacgaccagtcatggcagagcagagatactgtgtggaatatgccaaacgtggc
acggctggctgcaagaaatgcaaagacaagatcatgaaggggctggtccggattggcaag
atagtgccaaacccttttagtgagtctgcaggggaaatgaaggcgtggtaccacgtgaag
tgcatctttgagaagcttgagagagcacgcgccaccacaaagaagatcgacgacattaca
gagctggagggatgggaggaacttcaggatgaggataaagaactaatcaataaacatgtt
tcagaactggcaggcaaagccaatgcatctccaaagaagaaagtgcaagcaaagttaaac
aacagtgggcagctgtcagcaccgctagctgatccaacagtcaatgctcctcgcaagttt
tctggcttcacagctaacaaggcaggttcctcttcctccagtcctggaccatcttcagcc
aaacccactcagggtagctctttatcagctcatctatgtgaccccaaccataaagactgt
ttactgcgggagttccgcaaactttgtgccttagtcgcagagaagtccagctataacgca
aagacagagatcatcagagacttcttaacgaaaggctctggtggagacaaattctgcgga
gatttgtacctgacagtaaagcttctcctcccaggagtggttaagaatgtctacaacctc
agtgacaaacagattgtcaagcttttcagccgcatattgaattgcagtcaggatgagatg
gtgcaagacttggaacagggagatgtttcagagacggtgcggatatttttcgagcagagc
aagtctttccctctagcagccaagagtcttctgactatccaagaggtggatgcttcactg
agccgtctatcccaactcacaaaggaggatgatcagcaggcagagctgcaggacattgct
aaaaaatgcaccggaaatgatctgaagtgttacattcgtttggtcaagcatgatctgaaa
atcaactctggggctaaacatgttttggatgctgtggaccccaacgcctattatgccttc
aaagcctcccgtaaccttggtgacgtaatttaccgggtgctacggaaccagcaggatact
tttaatggaacagggcccagaaagatcctcagcgtggaggcgtctctgatgacccccgta
cagccaatgctggcagaagcatgtaagtccattgagtatgccatgaagaagtgtcctaat
gggatgtattctgagatcaagtatgatggtgagcgtgtgcaggtccataagaacggcaat
cacttcagttacttcagtcgaagtctcaaaccagtactcccacacaaggtcgcacatttt
aaagatttcataccgcaggcatttcctggtggccatagcatgatccttgatgctgaagtt
cttcttattgatacaaagactagcaaaccgctgccttttgggactcttggagtacacaag
aaagcagctttccaggacgctcaagtgggtctgttcgtgttcgactgcatttattttaat
ggtgtcagtctcatggacaagcctctctgtgagagaagaaagtttctccttgacaatatg
gtggaagttcctaacaggattcttttctcagaaatgaagcatgtcacgagagctgctgac
ctggcagaaatgatcacacgtgtcatcagagaaggactggaggggttggttctgaaggat
atcaagggacattatgaaccaggcaaacgacactggttgaaggtgaagaaggactatctg
aatgaaggagcaatggcggacaccgctgaccttgtggtgcttggagctttttatggcaaa
ggctcaaatggtggaattatgtccagtttcctcatgggatgctatgacccagaatccaag
aagtggtgcactgtgaccaagtgttcaggaggctatgacgacaccacgttagccagactg
cagaaggagttggacgttatcaaaattggcaaggatccaagcaagatcccaggatggttg
aagatcgtcaagagctattacccagatttcattatccgagatccagaaaaagcaccagtt
tgggaaataacaggagcagagttttccaaatcagaaatgcacactgcagatggcatatcc
atccgcttcccacgatgcactcgaatgcgagacgacaaggattggaagactgccactaac
cttcagcagctcaaggagctgtatcgtatttcaaaggagaactgtgattttgaggtgaca
gctggtccgtccaaaactagccaaaatgacaagagctcctcaggaggcgagagtggagga
agctctccctctatatctcatggagcttccacagctaacaagaccaaaaacggtcatact
cccaaagcaaaggcagtgaaaaccgaatcatcttcgccagcagttaagaggaaactaccc
acagagaaacaagatgccaagaagataaaaaccgaacctgtttacagcaatggacaaagc
aaattgcagaccgttcaaacaactgacacaaagaatgaaaagacactactggacattttc
acaggtgtgaagctctacctcccagagtcagtgcaggactttgagcagcttcggcgctac
ttcctagcttacgatggagatctggtgcatgagtatgactccgtttcagccacacataca
ctgggagagccagaggacgacagtccggctcagagggtcacctctaactggatctgggaa
tgcatccgaaagaggagggtggttcctccaagctga

DBGET integrated database retrieval system