KEGG   Sinocyclocheilus anshuiensis: 107690299
Entry
107690299         CDS       T04917                                 

Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04068  FoxO signaling pathway
sanh04217  Necroptosis
sanh04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107690299
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107690299
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107690299
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sanh03000]
    107690299
Transcription factors [BR:sanh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    107690299
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 Spectrin
Other DBs
NCBI-GeneID: 107690299
NCBI-ProteinID: XP_016344081
LinkDB
Position
Unknown
AA seq 806 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQTAT
TAQQDGQVAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
AGELSQDLNGNSQAAATRQKMSQLEQMLSALDQLRRQIVTEMAGLLSAMDFVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRSLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELN
YQLKIKVCIDKESGDGAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDINGKTQIQSVEPYTKQQLNSMSFAEIIMGYKI
MDATNILVSPLVYLYPDIPKEEAFGKYCRPEAQPDTEFPDPGCVIQPYLKTKFICVTPCP
SVFMDFPDSELLGNGFPGTNSGNTSDLFPMSPRTLDSLMHNEAAEANPGPLESLTLDMEM
SSDHPSPMREGFAASTVSDMDTCRNA
NT seq 2421 nt   +upstreamnt  +downstreamnt
atggcccagtggaatcagttacagcagttggagacgcggtatctggagcagctgtatcac
ctgtacagtgacagcttccctatggagctgcggcagttcttggccccctggatcgagagc
caggactgggcgtatgcggccaacaaggagtctcacgccacgcttgtgttccataacctg
ctgggggagatcgatcagcagtacagccgcttcctgcaggagaacaatgtcctgtaccaa
cacaacctgcggcgcatcaaacagcacctgcagagcaagtatctggagaagcccatggag
atcgcccgcatcgtggcccgctgcctgtgggaagagcagcgtctgctgcagacggccacc
actgcacagcaggatggccaggttgcccatcccactggcactgtggtgacagaaaaacag
cagatactggaacacaacctgcaggatattaggaagagagtacaggatatggagcagaag
atgaagatgttggaaaatctgcaagatgattttgacttcaactacaaaactcttaaaagt
gctggagagttgtcccaggacctgaatggaaacagccaggcagcagccaccaggcagaag
atgtctcagctggagcagatgctgagtgctctggatcagctgaggaggcaaatagtgact
gagatggcagggctgctgtctgccatggactttgtgcagaagaatctgacagatgaagaa
ctggccgactggaagaggagacagcagatcgcctgcattggaggaccaccgaacatctgc
ctggaccgcttagagacatggatcacctctttggctgagtcacagttgcagataagacag
cagatcaagaaactggaggagcttcaacagaaggtctcctacaaaggagatccgattatt
caacaccgcccagctctggaggagaagatcgtagacctgttccgcagccttatgaagagt
gcgtttgttgttgagaggcagccttgtatgcccatgcaccctgaccgaccacttgtcatc
aaaacaggagttcagttcaccaccaaagtcaggttacttgtgaaattcccagagttgaat
taccagctgaaaataaaagtgtgtattgacaaggagtcaggtgacggggcagccatccga
ggttcacgaaagttcaacatccttggcaccaacacgaaggtgatgaacatggaggaatcc
aacaatggcagcctgtcagcagagttcaaacatctgactcttcgagagcagagatgtggc
aatggaggccgaaccaacagtgacgcgtctctgatagtgaccgaagaactgcatctgatc
acgtttgagacagaggtctaccaccaaggactaaagatcgaccttgagacacattctctc
ccagtggtggtcatctctaatatctgtcaaatgccaaacgcatgggcgtccatcctgtgg
tacaacatgctgaccaaccatcctaagaacgtgaatttcttcaccaaacctccagtagga
acgtgggatcaggtggctgaggtgctcagctggcagttttcatccacaaccaagagagga
cttaccatcgagcagctcaccacacttgcagagaaacttctgggtccttgtgtaaactac
tctggttgccagatcacatgggccaagttctgcaaagaaaacatggcaggaaaaggtttc
tcattctgggtgtggctagacaacattatcgacctagtgaagaaatatattttggctcta
tggaatgaagggtatattatgggcttcatcagtaaagaaagagagagggcaatcctgagc
ccaaagcctcctgggacattcctgctgcgcttcagtgaaagcagcaaagagggaggcatt
accttcacctgggtcgagaaggacatcaatggtaagacccagatccagtcggttgaaccg
tacactaagcagcagctcaacagtatgtctttcgctgagatcatcatgggctacaagatc
atggatgccaccaacatcctcgtctcgccgctagtctatctctaccccgatatccccaag
gaggaggcgtttggcaagtactgccgccccgaggcccagcctgacactgaattccctgat
cctggatgtgtaattcagccttacctgaagaccaagttcatctgtgtcaccccgtgtcct
tccgtcttcatggacttcccagacagtgagctgcttggaaacggcttccctgggactaac
tctggcaacacaagcgatttgttcccaatgtcccctcgtacactcgactctctcatgcac
aatgaagctgccgaggccaacccaggaccactggaatctctcactctggacatggagatg
agctctgatcatccctcgccaatgagagaagggtttgcagcctccacagtctcagatatg
gatacctgccgaaatgcttag

DBGET integrated database retrieval system