KEGG   Sinocyclocheilus anshuiensis: 107690540
Entry
107690540         CDS       T04917                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04012  ErbB signaling pathway
sanh04068  FoxO signaling pathway
sanh04110  Cell cycle
sanh04115  p53 signaling pathway
sanh04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107690540
   04068 FoxO signaling pathway
    107690540
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107690540
   04115 p53 signaling pathway
    107690540
   04218 Cellular senescence
    107690540
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107690540
NCBI-ProteinID: XP_016344384
UniProt: A0A671LYS9
LinkDB
Position
Unknown
AA seq 145 aa
MAMHKRILRALRNVPTRRNLFGPVDREQLQLEYRDALRKDLEEASRRWSFDFVSETPLEG
GDFQWEGVSGEKVPVLYRAGQEGKHPRLRVGKENIPRTPERFSAVPQDVEKTPEKSTELK
RKQTNITDFYQAKKRVVATPGKSGQ
NT seq 438 nt   +upstreamnt  +downstreamnt
atggcgatgcacaagcggatcctgcgagctctcaggaacgtcccgacgcggcggaacctc
ttcgggccggtggatcgcgagcagctccagctggagtaccgcgacgctctgaggaaggac
ctggaggaagcatcccgccgctggagcttcgacttcgtctcggagacacctctggagggc
ggagacttccagtgggagggcgtgtccggggaaaaggtgcccgtcttgtaccgcgccggt
caggagggcaagcatccgcggctgcgcgtgggtaaagagaacatccccagaaccccagag
agattcagcgctgtcccgcaggacgtggagaaaacgccagaaaagagtacagagctgaag
aggaaacagacgaatatcaccgatttctaccaggcgaagaagagagtggtggccacaccc
ggcaaatcaggacaataa

DBGET integrated database retrieval system