KEGG   Sinocyclocheilus anshuiensis: 107690815Help
Entry
107690815         CDS       T04917                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2-like
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
Enzymes [BR:sanh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     107690815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core ASH DUF1573
Motif
Other DBs
NCBI-GeneID: 107690815
NCBI-ProteinID: XP_016344717
LinkDB All DBs
Position
Unknown
AA seq 678 aa AA seqDB search
MALDISTWDLACQFNNTDHHTELNGTDRLIVRRGQTFTINLYLNSDSYQPGYSQLHITAE
TGPQPEEQYGTRAVFGLSDEINDTCWSAAFSSPPGDTVCLSVCAAPDAPIGRYILTLDGR
IQFDFILLFNPWCPRDVVYMDSEEKLAEYVLAQDGIIFRGNAEYPVPIAWYFGQFEEGIL
DACLRILDMNPKHSRNPGKDCSGRRNVIYVTRVLSAMINSNDRDYGVLEGCWKDTFDGGV
SPMSWRGSVQILRTWSSTSCLPVRFGQCWVFAAVACTVSRALGIPCRVVTNFYSAHDTNS
NLVIERYLNEKGEIDSSTRDMIWNYHCWVESWMTRPDLPPGFDGWQASDPTPQEKSEGVF
CCGPVPVRAIKEGELTFKYDAPFVFAEVNADLVHILKYNDGSTRKIVNDQKVGQKISTKS
VGRDEREDITHLYKYPEGSAEERQVFEKANHQNKLHQQQANPGLQITIKLSTGIRKGCDF
DVFAIVTNKTEEDKKCRLVFASRAVSYNGVIGRECGFKDLLNVELAPGGERKVPLKLNYS
KYCTNLTEDNLIRLGALLIDYSTKEAMMAMRDIVLDDPEIKIRILGEPKEKRKLAAELTL
QNPLPETLQGCCFTIEGANLTGGSSITEKLESPVEPGQEAKVKIYFTPTQSGLRKLVVDF
DSDKLGHVRGYKNVIIGK
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggctctggacatcagcacctgggatctggcgtgtcagttcaataacacagatcaccac
acggagctgaacggcacggatcggctgatcgtacggagaggacagaccttcaccatcaac
ctgtacctgaactccgactcttaccagcccggatacagccagctgcacatcactgcagag
acaggccctcagccggaggagcagtatggcacgagggccgtgtttggcctcagcgatgag
atcaacgacacgtgctggagcgcagcgttcagcagtccacccggagacaccgtttgtctt
tctgtctgtgccgcgcctgacgctcccatcggccggtacatcttgactctagatgggcgc
atccagttcgacttcatactgctcttcaatccctggtgcccacgagatgtggtctacatg
gacagcgaggagaaactggccgagtacgttctggctcaggatgggatcatcttcaggggc
aatgccgaatacccagtccccatagcctggtattttggacagtttgaggagggcatactg
gacgcttgtttgagaatcctggacatgaaccctaaacacagtaggaaccctgggaaggac
tgttctggacgcagaaacgtcatttatgtcacaagagtgctgagtgctatgatcaacagc
aatgaccgggattacggcgtgctggagggctgctggaaggacacgtttgatggcggcgtg
agccccatgtcctggagaggaagcgttcagatcctgagaacgtggagcagcacttcctgt
ctgccggtgcgcttcggccagtgctgggtgttcgcagccgtcgcctgtacagtgtctcgt
gctctgggaatcccatgcagggtggtaacaaacttctattccgcccatgataccaacagc
aaccttgtaatcgagcgttatctcaacgagaaaggagaaatagacagcagcaccagagat
atgatatggaactaccactgttgggtcgagagctggatgacgcgacccgatctccctccg
ggttttgacggctggcaagcgagtgacccgacaccgcaggagaaaagtgaaggcgtgttc
tgctgcgggccggttcctgtgcgggcgataaaagaaggagagctgaccttcaaatacgat
gcaccatttgtgttcgcggaggtgaacgcagacttagtgcacatcctgaagtataacgat
gggagcacaaggaaaatcgtgaatgaccaaaaagttgggcagaagatcagcaccaagagc
gtaggccgagatgagagagaagacatcacacacctgtacaaatatcctgaaggttctgcg
gaggagaggcaggttttcgagaaggcaaaccaccagaacaagctgcatcagcagcaagcg
aaccctgggctgcaaatcaccatcaagctgtcgacggggatcaggaagggctgcgacttt
gacgtctttgcaatcgtgaccaataagaccgaggaggataagaagtgccgtctggtgttt
gcgtcacgcgccgtgtcatataatggcgtcatcgggcgcgagtgcggtttcaaagacctg
ctcaatgtggagctggcacctggaggagagaggaaggttcctctaaagctgaactacagt
aaatactgtactaatctaacggaggacaatctcatccgtctgggtgctctgctgatcgac
tacagcaccaaggaagccatgatggccatgcgtgacatcgtgctggatgaccccgagatc
aaaatcaggattctgggagaacccaaagagaagcgtaagctggcagcagagctcacccta
cagaacccgctgccagaaaccttacaaggctgctgcttcaccatcgagggagcaaacctc
accggcggcagcagcatcaccgagaaactggagtcacccgttgaacccgggcaggaggcc
aaagtcaaaatctacttcactcccactcagtctggcctgcgcaaactcgtggtggatttt
gacagcgacaagctgggccacgttagaggatacaagaacgttatcatcgggaaatga

DBGET integrated database retrieval system