KEGG   Sinocyclocheilus anshuiensis: 107692277Help
Entry
107692277         CDS       T04917                                 

Gene name
hdac4
Definition
(RefSeq) histone deacetylase 4 isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107692277 (hdac4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sanh03036]
    107692277 (hdac4)
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     107692277 (hdac4)
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     107692277 (hdac4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln TFIIA
Motif
Other DBs
NCBI-GeneID: 107692277
NCBI-ProteinID: XP_016346727
LinkDB All DBs
Position
Unknown
AA seq 1069 aa AA seqDB search
MPAVPSPSCCMLSEVFTASGRTFPDGLPSKEQPLELLKPSGVNHIPPVDVSAVLPLQVPP
SAIPMDLRVDHQFALAPTDSAQREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQH
EAQLQEHVKHQQDLLAVKHQQELLEHQRKLERHRQEQELEKQQREQKLQLLKNKERGQES
AVASTEVKMRLQEFVLNKKKALAQRSLNHCLPNDPRYWYGKTQHSSLDQSSPPQTGISTY
NHPVLGMYDPKDDFPLRKTASEPNLKLRSRLKQKVTERRSSPLLRRKDGPITTAKKRSLD
MAESACSSAPGSGPSSPNNSSNNITNENGIAGSISSSPAEPSLAHRLTGREGPVSQLSLY
TSPSLPNITLGLPATGPSSVASGLQDGDRMAVPGLQPGIPITTPFMPGAHLPSYLAASTL
EQEGGSAHNTLLQHMVLLEQSAAQNSLVAGLGGVSLQSHSIHKLRQHRPLGRTQSAPLPQ
NAQALQQLVVQQQHQQFLEKHKQQFQQQQLHISKMIAKPNEPGRQHESHPEETEEELREH
QGLGDSTEALPHGVTIKQEPPDEQDEEFQQREMQAEEELLFRQQALLLEQQRIHQLRNFQ
ASMEAAGLSMTFPGHRPLSRAQSSPASATFPIVVQEPPAKPRFTTGLVYDTLMQKHQCMC
GNSNNHPEHAGRIQSIWSRLQETGLRGQCECIRGRKATLEELQTVHTEPHVLLYGTNPLR
QKLDSSVTPMFVRLPCGGIGVDSDTIWNEVHSSSAARLAVGSVVDLVFKVASGELRNGFA
VVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKILIVDWDVHHGNGTQQAFYSDP
NVLYVSLHRYDDGNFFPGSGAPDEVGIGPGMGFNVNMAFTGGLEPPMGDADYLAAFRTVV
MPIANEFAPDVVLVSSGFDAVEGHLPPLGGYKLTAKCFGYLTKQLMGLAGGRLVLALEGG
HDLTAICDASEACVSALLGNELDPLPEDVLQQRPNPNAIHSMEKVLEVHSKYWCSLQRSA
STLGYSLLEAQRCETEEAETVTAMASLSVANKHMGKRTEEEPMEEEPPL
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atgccagccgttccctcaccatcctgttgcatgctttcagaagtctttacagcctctggc
aggacatttccagatggacttcccagtaaagaacagccactggaacttctgaagccatct
ggagtcaatcacattcctcctgttgatgtgagtgcggtgctgccactgcaagtgccgcct
tctgccatccccatggacctgcgtgtggatcaccagttcgccctggcgccgacggactcg
gctcagcgcgagcagcagctgcagcaggagcttctggccctcaagcagaaacagcagata
cagaggcagatcctgatcgcagagtttcagcggcagcacgagcagctctcgcgccagcat
gaagcgcagctgcaggagcatgtcaagcatcagcaggacctcctggccgtgaaacatcag
caggagctcctggaacaccagcggaagttggagcgccatcgtcaggaacaggagctggag
aaacagcagcgggaacagaagctccagttactcaaaaacaaagaacgtggccaagagagc
gctgtggcgagcactgaggtgaagatgaggttgcaggagttcgtcctcaacaagaagaaa
gcgctggcccagaggagcctcaaccactgcctgcccaacgacccgcgctactggtacggg
aaaacccagcacagctccctggaccagagctcaccacctcagacagggatttccacttac
aaccacccggtgctgggaatgtacgaccccaaagatgacttcccgctccgcaagacggca
tctgagcccaacctgaagctgcgatccaggctgaagcagaaagttacggagcgcaggagt
agcccgctgcttcggaggaaggatgggccgatcaccactgcaaagaagcgctctctggac
atggcagaatcggcatgcagcagtgctcctggttctggtccgagttcacccaacaacagt
tcaaacaacattaccaatgagaacggcatcgctggatcaatctccagcagtccagcggag
ccatctttggcgcacagactcacgggcagagagggtcctgttagccagctgtctctgtac
acatcgccctcccttcccaacatcaccctgggcctgccagccaccggcccctccagcgtg
gcgtctggcctacaggatggtgacagaatggcagtgccaggcttgcagccaggaataccc
ataaccactccgttcatgccaggagcccacctgccttcttacctggccgcgtccacctta
gagcaggagggcggctcggcacacaacactctcctgcagcatatggtgcttctggagcag
tcggccgcgcagaactccctggtcgcaggcctggggggcgtgtccctgcagtcgcattcc
atccacaagctccggcagcatcggcccctcggacgcacgcagtcggcccccctgccccag
aatgcccaggcgctgcagcagctggtggttcaacagcaacaccagcagttcctggaaaaa
cacaagcaacagttccagcagcagcagcttcacatcagcaagatgattgctaagccgaac
gagccgggccgacagcatgagagccacccggaggagacggaggaggagctgcgggagcac
caggggctgggcgactccacggaggctcttcctcacggggtcaccatcaaacaggaacct
ccggatgagcaggatgaagagttccagcagagagagatgcaagccgaggaagagctgctc
ttcagacagcaagctctcctgttggagcaacagaggatccatcagctgaggaactttcag
gcatccatggaagcggccggtctgtctatgaccttcccaggccaccggcccctgtccaga
gcacaatcatccccggcctctgcgacctttcccattgtggtgcaggaacctccagccaaa
ccgcgctttaccaccggtctggtgtacgacaccctgatgcagaaacaccagtgcatgtgt
ggaaacagtaacaaccaccccgaacacgccgggcgcatccagagcatctggtcacgactg
caggagacgggactgcgcggccagtgtgagtgtattcgaggcaggaaagccactctggag
gagctacagacggtccacactgagcctcatgtgctgctttacggaaccaaccctctcaga
cagaaactggacagctcagtgacacccatgttcgtgagactgccgtgcggaggaatcggg
gttgacagtgacactatctggaatgaagttcactcgtccagtgctgctcgtctggctgtg
ggatctgtagtggatctggtgtttaaggtggcttcaggagagctgaggaacggctttgct
gtggtacgacctccaggacatcacgctgaggagagcactcccatgggattttgctatttc
aactcggtcgccattgcagccaaactcctgcagcagagactcaacgtcagtaagattctc
attgtggactgggatgttcaccatggaaatgggactcaacaggccttctacagtgaccct
aatgtcctgtatgtgtctctccatcgctacgatgatgggaacttcttccctggcagcgga
gcccctgatgaggtgggcatcgggccaggcatgggctttaacgtgaacatggccttcacc
ggaggtctggagccgcccatgggagacgcagactatctggcagcattcaggacggtggtg
atgccaattgcgaacgagttcgctccagacgtggtgctggtttcttcaggcttcgacgct
gtggaggggcatctgccacctctgggaggatacaagctcacggccaaatgtttcggctac
ctgaccaagcagctgatgggactggccggcggccggctggtgctcgcgctggaggggggt
cacgacctcaccgccatttgcgatgcctctgaagcatgtgtttctgctttgcttggaaac
gagttggaccctcttcctgaagacgtgctacaacagaggccgaaccccaacgccattcac
tccatggagaaagttctggaagtccacagtaaatactggtgctcgctgcagagatctgcc
tcgactctgggatactcactgctggaggctcagagatgtgaaactgaagaggcagagacg
gtgaccgccatggcctccctgtctgtggccaacaagcacatgggaaagaggacagaggag
gagcctatggaagaggaacctccattgtag

DBGET integrated database retrieval system