KEGG   Sinocyclocheilus anshuiensis: 107692649Help
Entry
107692649         CDS       T04917                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00052  Galactose metabolism
sanh00500  Starch and sucrose metabolism
sanh01100  Metabolic pathways
sanh04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107692649
   00500 Starch and sucrose metabolism
    107692649
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107692649
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107692649
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107692649
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107692649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 GHL15
Motif
Other DBs
NCBI-GeneID: 107692649
NCBI-ProteinID: XP_016347296
LinkDB All DBs
Position
Unknown
AA seq 959 aa AA seqDB search
MVSYKRLTPEEVHFAGAALLDPDETTDTDLKEVNPELLLLPQSRRCSITVALLTLGGLIV
VLFGIWLLGTIFWLHKPPSTEPHRPPPPAVAKSPNGTWLQPEPCSQIPEAWRFDCYPERG
AVVTEEMCHARNCCFIQRSQAKTSGRNGVPWCFYTPDYPSYELVSITDTEIGKVGKLLRN
KKTYYPKDIDALQMEVLYEEDNRLRVKITDPAEKRYEVPIDVPVVQKKAPNPSYTVDFIK
EPFGLIVKRTQTGTVLLNTSIAPLFYADQFLQMSTLLPSRFIYGLGEHRSNFLHDVQWNT
LTMWARDVPPMELTNLYGVHPFYLSMESDGMAHGFFMLNSNAMDVALQPAPALTWRMIGG
ILDFYIFLGPDPSSVIAQYLDVVGKPAMPIFWALGYHLCRWGYKTSNKIWNVVKEMRNYG
IPQDVQWNDIDYMDHALDFTYDTVNFSSLPDLVKDLHRHDQHYVMILDPGISNSQLPGSY
WPFDEGMKRGIFINDSNGDVLIGKVWPGLTAFPDFSNPDTHEWWYQNLKRFHEKVPFDGV
WIDMNEPSNFFDGSLNGCPDNELENPPYTPGILGGTLKAKTVCASARQKISTHYNIHSLY
GLMEAKATESALRKITNKRPFVISRSTFPSQGKYSGHWLGDNRSQWKDLATSIPGMLTFN
ILGIPLIGADICGFGGSTTEELCVRWTQLGAFYPFSRNHNSIDEQDQEPTAFSPAARTAM
KEAILLRYSLFPHLYTLFHHAHISGHTVVTPLLFQFLTDEKTYGIDKQFLWGKSLLVTPV
LEAGRDYVVGYFPKGLWYDFHTGDSLISSGEEINLQAPKDKINLHLREGSVIPTQRPNAT
LWVSSGQPLHLIVSLSEDGLAKGDLFWDDGETLDTYEKDQYAYIYFTVEQNTMTSEVLHN
HEEATYITVETVSFYGVKTEPENVTVNSQEAAFTYRNNQVLTVTDLGLNLSHNFTISWM
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgtacaagagactcacccctgaggaggttcatttcgcaggagctgctttattg
gatcctgatgagacgacagacacagatctaaaggaagtaaacccagaactgctcctgctg
ccccagagccgtcgctgctccatcaccgttgccctgctgacccttgggggacttattgtg
gttctctttggcatctggctgcttggaactatattttggttacataagccaccctccaca
gaaccccatagaccccctccacctgctgtggctaaaagcccaaacgggacgtggctgcag
ccggagccctgctcgcagattccagaagcttggaggtttgactgttatccagagagaggt
gcggtggtcacggaggagatgtgccacgctcgaaactgctgcttcatacagcgctcacag
gctaagacatcgggacggaatggagtgccgtggtgtttctacacacctgactatccatcc
tacgagttggtgtccattactgacacagagatagggaaggtgggaaaactgctccggaac
aaaaagacgtattatcctaaagacatagatgcactgcagatggaggtgctgtatgaggaa
gacaacagactgcgtgtgaagataacagacccggctgaaaagaggtatgaggtgcctata
gatgttcctgtggttcagaaaaaagcaccaaatccctcttacaccgtagacttcatcaaa
gaacctttcgggctgattgtcaagagaacacagacaggaactgtactgttgaatacatct
atagctcctctcttctacgcggatcagttcctgcagatgtctacattattaccttcacgt
ttcatatatggactgggtgaacatcgctccaactttctgcatgacgtccagtggaacact
ctcaccatgtgggctcgagatgtcccaccaatggagctgaccaacctctatggcgtccat
cccttttatctttctatggaatctgatggaatggcacatgggtttttcatgctcaacagc
aatgcaatggatgtggctctgcagcctgctcctgccctcacctggcgtatgattggtggg
atcctcgacttttacattttcctaggcccggatcccagctctgtaattgcacagtacttg
gatgttgtagggaagcctgcaatgcccatcttctgggctctgggttatcatctttgccga
tggggctacaagacaagcaacaaaatctggaatgttgtaaaagaaatgcggaattatggg
atacctcaggatgttcagtggaatgacattgactacatggatcatgccttagacttcact
tatgacactgtgaacttttccagcctacctgaccttgtgaaagaccttcatagacatgat
caacactacgtcatgatcctggatcccggtatcagtaactctcagctgcctggctcctac
tggccatttgatgaggggatgaagaggggcatcttcatcaatgattcgaatggagacgtc
cttatcgggaaggtctggccaggactcacagcttttccagatttctccaatccagacaca
catgaatggtggtaccagaatctgaagcgtttccatgaaaaagtaccatttgatggcgtg
tggattgacatgaatgagccatctaatttctttgatggatcactgaatggttgcccagac
aatgaactggaaaatcctccctacacaccaggtattctgggtggtacattaaaggccaag
actgtgtgtgcatctgcaagacagaaaatctccactcactacaacatacacagtctgtat
ggactcatggaagctaaggctactgaaagtgctttgaggaagatcacaaataagcgtccc
ttcgtcatttcccgctctacgtttcccagtcagggcaagtattcaggccactggctcgga
gacaacaggagccaatggaaagacctggccacatccataccaggtatgctaacatttaac
atcctgggcattcctcttattggggctgacatctgtggctttgggggcagcactacagaa
gaactgtgtgtacgatggacccagcttggagctttctaccccttttcaagaaatcacaac
tccatagatgaacaggatcaggaaccaacagcattcagcccagcagctcgtacagcaatg
aaagaagccattctcctgcggtattccctgttcccacatctctacacactcttccatcac
gcacacatcagtggacacacagtcgtcacaccactgctctttcagttcctgaccgatgag
aagacgtacgggatagataaacagttcctatggggaaagagtttgctggtcacaccggtt
ttggaggcagggcgagattatgttgtgggatatttccctaaaggtctctggtacgatttc
cacactggtgactcgttgataagcagtggagaagagatcaatcttcaggctccaaaagac
aaaatcaacctgcatctcagagagggttcagtcatacctacacagagacctaatgccacc
ctgtgggtgagcagcggtcagccccttcatctgattgtgagtctgagtgaggacggcctg
gccaagggtgatttgttttgggatgatggagagacccttgacacatatgagaaagatcaa
tacgcttacatctatttcacggtagaacagaacacaatgacatcagaagtgctgcataat
catgaggaggctacttacatcacagtggaaaccgtttcgttttatggagtgaagacagag
ccagaaaacgtaacagtgaattcacaagaggcagcattcacttaccgtaacaatcaggtg
ctgacagtaacagacttgggtctgaacctcagtcataacttcacaatcagttggatgtaa

DBGET integrated database retrieval system