KEGG   Sinocyclocheilus anshuiensis: 107692877Help
Entry
107692877         CDS       T04917                                 

Definition
(RefSeq) DNA ligase 1-like isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh03030  DNA replication
sanh03410  Base excision repair
sanh03420  Nucleotide excision repair
sanh03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107692877
   03410 Base excision repair
    107692877
   03420 Nucleotide excision repair
    107692877
   03430 Mismatch repair
    107692877
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sanh03032]
    107692877
   03400 DNA repair and recombination proteins [BR:sanh03400]
    107692877
Enzymes [BR:sanh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107692877
    6.5.1.6  DNA ligase (ATP or NAD+)
     107692877
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107692877
DNA replication proteins [BR:sanh03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    107692877
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     107692877
DNA repair and recombination proteins [BR:sanh03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107692877
   NER (nucleotide excision repair)
    Other NER factors
     107692877
   MMR (mismatch excision repair)
    Other MMR factors
     107692877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 107692877
NCBI-ProteinID: XP_016347568
LinkDB All DBs
Position
Unknown
AA seq 980 aa AA seqDB search
MQRSIASFFQPMKSKEKSDGQVKAKTEPVKSPLKIQNGMQENDSPVKKVHKRSRAIIDSD
DEDQPIVKEQVLKQSEVQTAKPEKAASTVSPKTPITPTTPVTLSTSVAVVTPASSGAPGT
PATPTSTSPSGIPKRKTARKHFPKRKLESRSDGEGTKEEENEVDGEQESKRARVESSPGK
TDNEMMEVEEKRADGKTAVEEQKGEDKAKSTVVEDDANNEMKEKDKSDIKQEKKINGENG
KKEKKEGKKEKEDSSPERVVKKEKNTEEEGGSAKKKPISSFFAPRKAAVKLEKEEQIEGE
KKKNGEISDAAEQKEKKSEKGMDSAVQSQYDPSRAHYNPVDHACWQKGQKVPYLAVARTF
EKIEEDSGRLKNIETLSNFLRSVILLSPDDLLCCVYLCLNQLGPAYQGLELGVGETVLMK
AVAQATGRQLDKIKAEAQEKGDLGLVAESSRSNQRMMFAPANLTAGGVFNKLKEIANMSG
NSAMNKKIDIIKGLFVACRFSEARYIARSLAGKLRIGLAEQSVLSALNQAVCLSPPGQEF
PPAVLDAGKGMSAENKRAWMEEKALILKQTYCEMPNYDAIIPVLLKEGIDELPNHCKLTP
GVPLRPMLAHPTKGVGEVMKRFDEASFTCEYKYDGERAQIHILENGEVRIFSRNQEDNTS
KYPDIISRIPQVKKENVRSCVLDSEAVAWDREKKQIQPFQVLTTRKRKDVDASEIKVQVC
VYAFDLLYLNGESLVREPLSKRRALLWESFEEKEGEFVFARSLDADNTEAIAEFLEQSVR
DSCEGLMVKTLEKHATYEIAKRSHNWLKLKKDYLEGVGDTVDLCVIGAYLGKGKRAGSYG
GFLLACYDEENEEFQSVCKIGTGFKDEDLEQHYNLLKEHILSKPRPYYRVDQSAEPDVWL
EAVQVWEVKCADLSLSPVYKAAMGLVDPEKGISLRFPRYLRIRDDKKPEDATTGSQIADL
YKKQQQIQNQGEKQDLEDYY
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcatagcatctttctttcagccaatgaaaagcaaggaaaagagtgatgga
caggtcaaagcaaaaaccgaacctgtaaaaagtcccctcaaaattcagaatggcatgcag
gaaaatgattcacctgtaaagaaggttcataaacgcagtcgagcaatcatagacagcgat
gatgaagatcagccaatagtaaaagagcaggtgctaaaacagagtgaagttcaaacagca
aagccagagaaggctgcttccactgtatctccaaaaactcccataaccccaacaactcct
gtcacgttgagtacctctgttgccgtggtaacccctgcttcctcaggtgctccaggaact
ccagcaactccgacatcaacatcgccgtcaggcattcccaaacgcaagactgctcgcaag
catttccccaagaggaagctggaaagcagaagtgatggagaggggacaaaagaggaggag
aatgaggtcgatggagagcaggaaagtaagagagcacgagtagagtcttcacctggaaag
acagacaacgagatgatggaggtggaagagaagagagcagatgggaagactgctgtggag
gaacagaaaggagaggataaagcaaaatcaaccgtagttgaggacgatgcaaacaatgag
atgaaagaaaaggataaaagtgacataaaacaggagaaaaagataaatggagaaaatggg
aagaaagaaaaaaaagaaggcaagaaagagaaggaagatagcagtcctgaacgagtggtt
aaaaaagaaaaaaacacagaagaggaagggggatcggccaaaaagaaacctatcagcagc
ttttttgctcccagaaaggcagctgtaaaactggaaaaagaggagcaaattgagggagaa
aaaaagaagaatggagagatctctgatgctgctgaacagaaagagaagaaaagtgaaaag
gggatggattctgcagtccagagccagtatgatccctccagagcacattacaatcccgtt
gaccacgcttgctggcagaagggccaaaaagtgccatatttggctgtcgctcgcaccttt
gagaagattgaagaggattcgggcaggctgaagaacattgaaaccctttccaactttctg
cgatctgtaattctactctctcccgatgacctgctatgctgtgtgtacctgtgtctgaat
cagctcggccctgcatatcagggtctggagctgggtgttggggagaccgtcctgatgaaa
gctgttgctcaagcaactgggcgacaactggacaaaatcaaggcggaggctcaggagaaa
ggtgacctgggattggttgctgaaagttcccgtagcaaccagagaatgatgtttgcaccg
gccaatctgacagcagggggcgttttcaacaaactgaaagagattgctaacatgagtgga
aactctgcaatgaataagaagattgacattattaaaggcctctttgtggcatgtcggttt
tctgaggctcgatacattgccaggtcactggctgggaagctgcggatcggattggctgag
cagagcgttctctcggctctcaatcaggctgtgtgtctgtcgcccccgggccaagagttc
ccaccggctgtgctggatgcagggaaaggaatgagtgcagaaaacaagagagcgtggatg
gaagagaaagcactgatcctgaaacagacatactgtgagatgccaaattatgatgctatc
attcctgtattgctgaaggagggcatagatgaactgcccaatcactgcaagctcacccca
ggtgttcccctgcggcccatgttggctcacccgacaaaaggggtcggtgaggtaatgaaa
cgttttgatgaggcatctttcacctgcgagtataaatatgatggagagagagcccagatc
catattcttgagaatggagaggtgcgcatttttagccgaaaccaagaggacaacacaagc
aaataccctgatattatttcacgaatcccacaggtgaagaaagagaacgtacggtcctgt
gttctggattcagaggcggtggcctgggacagagaaaagaaacagatccagccgtttcag
gtcctcaccacgaggaagaggaaggatgtggatgcatctgagatcaaggttcaggtgtgt
gtgtacgcctttgatctgctgtacctcaacggagagtctctggtgcgagagcctctaagc
aaacgcagggctctgttatgggagagttttgaggaaaaagaaggagagtttgtttttgct
cgatctctggacgctgacaacacggaggccatcgctgagtttctggagcagtctgtacga
gattcttgtgagggcctaatggtgaagacattggaaaaacatgcaacttatgagattgcc
aaacgctcccacaactggctcaagctgaagaaggattatctggagggtgttggagacaca
gtggatctgtgcgtgattggtgcttatctgggaaaggggaagagagcaggcagctatgga
ggatttctactggcctgctacgatgaggagaacgaggagttccagtctgtctgtaagatt
ggaacaggcttcaaagatgaagatctggagcaacattacaatcttttaaaggagcacatc
ttatctaaaccacgcccatattaccgtgtggaccaatcagcagagccggatgtctggctg
gaggcggtacaagtgtgggaggtgaaatgcgctgacctttcactgtctccagtctacaag
gcagcaatgggattggtggacccagagaaaggcatttcactccgtttcccacggtacctc
aggattagagatgacaaaaaaccagaggatgccaccacagggtcacagattgcagatctc
tacaagaagcagcagcagattcaaaaccagggtgaaaaacaagatctggaagactactat
tga

DBGET integrated database retrieval system