KEGG   Sinocyclocheilus anshuiensis: 107692926
Entry
107692926         CDS       T04917                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107692926
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sanh03000]
    107692926
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sanh03310]
    107692926
Transcription factors [BR:sanh03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    107692926
Nuclear receptors [BR:sanh03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   107692926
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 107692926
NCBI-ProteinID: XP_016347614
LinkDB
Position
Unknown
AA seq 727 aa
MDGGQKCSSNNAENLTLGDCIERGFVPDIGVNVSSLNTPKDFSNGQSGSDAQRNLSVANP
SLMGRNIQEPDVMAYKPFRMQHQQKVKEPLIGENFSLLDESIADLNRGSGIQAPDTFTMK
MEQFSPIEKDRLDFPPYGHLDKELDGNERVIGDNTIDILKDLDLPDSLSDLNELYVADEA
AFLSSLAVDDALLGESNFLKDTSPVVTGNSAAYTNVNGMGKRQQMVEASVNMPVIKTEKD
TDFIQLCTPGVIKQENERRSYCQMSGMGGPHGGPATLGDMGGQTYHYGANTASPVSLPDQ
KPPFGLFSPLPNLSDGWVRGNGYGDPSGMQRANETVLPTTYPYSSSLARPEASSSSSSGS
VKPGGNTHKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRR
KNCPACRFRKCLQAGMNLEARRNKKLMRLRGHSSSSEQAPALPEESMCSLVPKAMPQLVP
TMLSLLKAIEPEIIYAGYDSTIPDTSTRLMTTLNRLGGRQVISAVKWAKSLPGFRNLHLD
DQMTLLQCSWLFLMSFGLGWRSYQQSNGDMLCFAPDLVINEERMKLPYMNDQCSQMLKIT
NELVRLQVSNDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMSYIKELGKAIVKREENSSQ
NWQRFYQLTKLLDSMQEMVEGLLNFCFYTFVNKSLSVEFPEMLAEIISHQLPKFKDGSVK
PLLFHQK
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggacggtggacaaaaatgcagcagtaacaatgctgagaatttaactttgggggattgt
atcgagagaggcttcgtgcctgatattggtgtcaatgtgtcctctttaaatacgccaaaa
gatttctcgaatggacagagcggtagtgacgctcaaagaaatctctcggtggcaaatcca
tccttaatgggacgtaacatacaagaaccagatgttatggcgtataaacctttcagaatg
cagcaccagcaaaaggtaaaagagcccctcataggggagaacttttcgctcttggacgag
agcattgcagacttaaatcgtggttctggcatccaggcccctgacacttttacaatgaaa
atggagcagttttccccgatagagaaagataggctggactttccaccctatggccacctg
gataaggaattggatggtaatgagagagtgattggagacaacaccattgacatccttaag
gatctagacttacctgactccctatctgacctgaatgagctctacgttgccgacgaggct
gcctttctttcctcgttggctgtggatgatgccctgctgggagagagcaactttctgaag
gataccagccctgttgtcactggcaacagtgcagcctacacaaatgtgaacggcatgggg
aaacggcagcagatggtagaagccagtgtcaacatgccggtcataaagacagagaaagac
acagactttatccagctgtgtacaccgggtgtcatcaaacaggagaatgagaggcggagc
tactgtcagatgtcagggatgggtgggcctcacggtgggcccgccacgttgggagatatg
ggcggacagacataccactatggagccaacaccgcctcacctgtgagtttaccagatcag
aaacctcctttcggcctgttttctcccctacccaacttaagtgatggctgggttcgagga
aatggatatggagatccgtctgggatgcagagagccaatgagactgtacttccgacaacc
tatccatacagcagctctttggccaggcctgaagcgagcagctccagttcgtctggatca
gtcaagcccggcggaaacacccataagatctgcctggtgtgctccgatgaggcctctggg
tgtcattatggggtgctcacctgtggcagctgcaaggttttcttcaaaagagctgtagag
gggcagcacaactatctctgcgctggaaggaatgattgcatcatagacaagataagaagg
aaaaactgcccggcatgccgctttcgcaagtgtcttcaggccggcatgaacttggaagct
cgaagaaacaagaaactgatgcgattacggggtcattcgtcctcaagtgagcaggcccca
gctctgcctgaagagagcatgtgttcactggtgcccaaagccatgccccagctggtgccc
accatgctgtccctgctcaaagccattgagcctgagatcatttacgcgggttacgacagc
accatcccggacacctccacccgcctcatgaccacacttaaccgtctgggaggccgtcag
gtcatctctgcagtcaagtgggccaaatcccttcctggcttcagaaacctgcacctggat
gaccagatgacgctgttgcagtgctcctggctcttcctcatgtccttcggcttgggctgg
agatcctaccagcagagtaacggagacatgttgtgtttcgctccagacctcgtcatcaat
gaggagaggatgaaactaccctacatgaatgaccagtgtagccagatgctgaagatcacc
aatgagctggtcaggctgcaggtgtccaatgacgagtatctctgcatgaaagtgctcctc
ctcctcagcacagtaccaaaggacggccttaaaagccaagctgtgtttgatgaaatccgc
atgtcgtacatcaaggagctgggcaaagccattgttaaacgcgaggagaactccagccag
aactggcagaggttctaccagctcactaagcttttggactcaatgcaggagatggtggag
gggcttctcaacttctgtttctacacatttgtgaataaatctctgagcgtggagtttcct
gagatgttggcggagatcatcagccatcagctaccaaaatttaaagacgggagtgtcaag
cctcttctgttccatcagaaatga

DBGET integrated database retrieval system