KEGG   Sinocyclocheilus anshuiensis: 107693165Help
Entry
107693165         CDS       T04917                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SMYD3-like isoform X1
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00310  Lysine degradation
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107693165
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sanh03036]
    107693165
Enzymes [BR:sanh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107693165
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     107693165
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107693165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TPR_12 zf-MYND TPR_2 TPR_MalT
Motif
Other DBs
NCBI-GeneID: 107693165
NCBI-ProteinID: XP_016347935
LinkDB All DBs
Position
Unknown
AA seq 436 aa AA seqDB search
MMAVNMERFVSEAKGNGLRALREIKAGEVIHSCEPYAFCIAKDFLKTACQSCLKRGESLS
RCSQCKTARYCSAQCQKQAWPDHKRECKCLKRLQPRIPTDSVCLVARIIFKLLSQSESDQ
EELYSIVEHQSHLADMSEEKKEGLRHLCMTLQVYLGEENHDLSPLPPGLDPISLLARVTC
NCFSISDGELQDVGVGLYPSMSLLNHDCQPNCVMIFEGKRLMLRAVRLIRPCEELTISYT
DILATSKERRSHLQEQYHFLCQCTRCSTEDKDCDMLAGEKTAWTSLRDAIPHLEQLQSEQ
RILHSRIRGWEELLKEGKAFLHRYADVVPDRNIYVLRLLDLAMDACISLDDYETALEYGN
RALESYKLYYSDPHPSRAVELLRVGKLQHYQGRLEEAQGSFTQAYDIMKVTHGTAHALTN
EVSRKLSECQAELGRV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgatggctgtgaatatggagaggtttgtcagtgaggctaaaggaaatggtttgcgtgct
ctgcgtgaaatcaaagccggtgaggtgattcattcatgcgagccgtatgcattctgcata
gccaaagatttcttgaaaactgcctgccaaagttgtctcaagagaggtgaaagtctgtcg
agatgttctcagtgtaagacggcccggtactgcagtgctcagtgtcagaagcaagcatgg
cccgatcacaagagggaatgcaaatgcctcaagcgcctccagccacggatccccaccgac
tccgtctgcctggtggcgaggatcattttcaaactgctcagccaatcagaaagtgaccaa
gaggagctgtactcgatagtcgagcaccagtcacatcttgcagacatgagcgaggagaag
aaagaaggcctgaggcacctctgcatgacgctgcaggtttatctcggtgaggagaaccac
gatctgtctccgcttccgcccggcctcgaccccatcagcctcctcgccagagtgacctgc
aactgtttcagcatcagtgatggagagctgcaggacgtgggggtgggactttaccccagc
atgtctctgctgaaccatgactgccagcccaactgtgtcatgatctttgagggcaagaga
ctcatgctgcgagccgttcgcctcatcagaccctgtgaggagctcactataagctacacc
gacatcctcgcaaccagcaaagagagacgttcccatttacaggagcaataccacttcctg
tgtcagtgcacacgctgtagcactgaggacaaggactgtgacatgctggctggagagaag
acggcatggacgtccttaagagacgccatcccgcacctggagcagcttcagtcggagcag
cgtatccttcacagccgaatcaggggctgggaggagctgctgaaagagggcaaggctttt
ttgcacagatacgcagatgtcgtcccggacaggaacatctatgtgctcaggctgctggat
ctggccatggatgcttgcattagtctggacgactatgagacggcgctggagtacggcaac
agagctctggaatcttacaaattgtactacagtgatcctcatccatccagagcggtggag
ctgctgcgggtggggaagctgcagcactaccagggcagactggaggaggctcaggggagc
ttcacacaggcctatgacatcatgaaggtgacccacgggacggctcacgccctgactaat
gaggtgagcagaaaactgagcgagtgccaggctgagctgggtcgagtctag

DBGET integrated database retrieval system