KEGG   Sinocyclocheilus anshuiensis: 107694085Help
Entry
107694085         CDS       T04917                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00020  Citrate cycle (TCA cycle)
sanh00190  Oxidative phosphorylation
sanh01100  Metabolic pathways
sanh01200  Carbon metabolism
Module
sanh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sanh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sanh_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107694085
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107694085
Enzymes [BR:sanh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107694085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 107694085
NCBI-ProteinID: XP_016349167
LinkDB All DBs
Position
Unknown
AA seq 662 aa AA seqDB search
MAAVCAASRVLGRKIVSSKALPAVCQASNRKLHFSIYGKKGDAKVSDGISTQYPVVDHEF
DAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDDWRWH
FYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTEEGRIYQRAFGGQSLKFGK
GGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECKGVIALCMEDG
SIHRFRAKNTVIATGGYGRTFFSCTSAHTSTGDGNAMVTRAGLPCQDLEFVQFHPTGIYG
AGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGVGPVKD
HVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQAI
THENGEDMVVPGLYACGEAGCASVHGANRLGANSLLDLVVFGRACALTIAETNTPGEKLS
PLKPNAGEASVANLDKIRFANGSTRTSEIRLNMQKTMQNHAAVFRTGDVLKEGCEKMDSV
YKSMDDIKTFDRGIVWNTDLVETLELQNLMLNAVQTIVSAEARKESRGAHAREDFKDRED
EYDYSKPLQGQVKKPFEQHWRKHTMSYVDPKTGKVTLEYRRVIDSSLNADDCAAIPPAIR
SY
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggtctgcgctgcctcccgtgtcctcgggagaaagattgtatcatctaaagct
ctgccagcggtgtgccaggcgagcaaccgcaagttgcatttctcaatctatggaaaaaag
ggagatgcaaaagtctcagatggtatctccactcagtatccagtagtagaccatgagttt
gacgctgtcgtggtgggagccggtggcgcaggcctgcgtgctgcgttcggtctgtcggag
gccggttttaacacagcctgtgtcaccaaacttttccccacccgctcacacacggtggcc
gcacagggtggaattaatgctgcattaggcaacatggaggaggacgactggcgttggcac
ttttatgacacagtgaagggatctgattggctgggagaccaggatgccattcactacatg
acagagcaggcacctgctgcagtggtggagctggagaacttcggtatgccattcagccgt
accgaggaagggaggatctatcagcgtgccttcggaggccagagtctgaagttcggtaaa
ggaggtcaggctcacagatgctgttgtgtggcagacaggacgggtcactctcttcttcac
acactctatggacggtctctaaggtatgacactagttactttgtggagtattttgccctg
gatctgctgatggaggatggcgagtgtaagggagtcatcgcactgtgcatggaggacgga
tccatccaccgattcagagccaagaacacagtcattgccacaggaggttatggccgcaca
ttcttcagctgtacttcagcccacaccagcacaggagacggtaatgccatggtgacccgt
gctggactgccctgccaggatctcgaatttgtgcagttccaccccacaggaatctatgga
gccggatgcctgatcacagagggctgccgtggagagggaggaatcttgatcaacagtgaa
ggcgagaggttcatggaacgttacgcacccaatgccaaagatttggcctctagggacgtg
gtctcacggtccatgaccattgagatcagggaaggaagaggtgttgggccagttaaagac
cacgtctacctgcagctccatcatcttccgccccagcagcttgctactcgcctgcccggc
atctctgagaccgccatgatctttgctggagtggacgtcacgaaagagcccatcccagta
ttacccaccgtccactacaacatgggcggcatccccaccaactacaagggacaggccatc
acccatgagaatggagaggatatggtggtgccaggcctgtacgcctgcggtgaggccggc
tgtgcatcggtgcatggtgcaaatcgtctgggcgccaactcactgctggatctggttgtg
tttggacgcgcttgtgccctgaccattgctgagaccaacactccaggagagaagctttcc
cctctgaaacccaatgcaggagaagcatctgtcgccaatctggacaagatacgctttgct
aacggcagtaccagaacctcagagatcagactgaatatgcagaagaccatgcagaatcac
gctgctgtgttccgcaccggagacgtcctgaaggagggttgtgaaaagatggactccgtc
tacaagtctatggatgacatcaagacatttgacagaggcattgtctggaacactgatctg
gtggaaactctggagctgcagaatctgatgctgaacgcggtgcagacaatcgtctccgct
gaggcgcgtaaagagagcagaggagctcacgcacgcgaggacttcaaggaccgtgaggat
gagtacgattactccaagcctctgcaaggacaagtgaagaagcctttcgagcagcactgg
aggaaacacacaatgtcctacgtggatcccaagacaggaaaggttactctggaatacaga
cgtgtgattgacagctctctgaacgcagatgactgtgctgctattccccctgcaatccgt
tcctattaa

DBGET integrated database retrieval system