KEGG   Sinocyclocheilus anshuiensis: 107694143
Entry
107694143         CDS       T04917                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1C-like
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04010  MAPK signaling pathway
sanh04020  Calcium signaling pathway
sanh04260  Cardiac muscle contraction
sanh04261  Adrenergic signaling in cardiomyocytes
sanh04270  Vascular smooth muscle contraction
sanh04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107694143
   04020 Calcium signaling pathway
    107694143
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107694143
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107694143
   04261 Adrenergic signaling in cardiomyocytes
    107694143
   04270 Vascular smooth muscle contraction
    107694143
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sanh04040]
    107694143
Ion channels [BR:sanh04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107694143
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 107694143
NCBI-ProteinID: XP_016349234
LinkDB
Position
Unknown
AA seq 2088 aa
MARFEVLAFLHYSFSGSNYSSPSLAPVPSLNEDERVGGGGGVLGLAPEHIPTPGAPISWQ
AAIDAARQAKLMGTTGAPISTASSTQRKRQHYTKPKKQASTASTRPPRALLCLTLKNPIR
RACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEA
FLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTSMGGKAAGFDVK
ALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKM
HRTCFFFKDGHKGPISELKPAPCAPNSAHGRHCTPANITQCMMGWEGPNDGITNFDNFAF
AMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKE
REKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENDDEGLDDDKPRNRNMPASEN
ESVNTDNAPAGDMEGETCCTRMANRISKSKFSRYSRRWNRLCRRTCRAAVKSNVFYWLVI
FLVFLNTLTIASEHHQQPEWLTNVQEIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRF
DSFVVCGGILETILVEIKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSI
ASLLLLLFLFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTVFQILTGEDWNSVMY
DGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEK
ERKKLARTASPEKRQDSEKPPLEDEKKEEKIELKSITSDGETPTANKINIDEYTGEENEE
KNPYPVNDFPAGEEDDEEPEMPVGPRPRPLSDIQLKEKAVPMPEAKAFFIFSATNKFRVL
CHKIVNHNIFTNLILFFILLSSISLAAEDPVNNDSFRNQILGYADYVFTGIFTIEIILKM
TAYGAFLHKGSFCRNYFNXPFXLVVPNCAVIHRSSAINVVKILRVLRVLRPLRAINRAKG
LKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFSYCTDTSKQTQTECRGSYI
LYKHGNVGKPEKAQRSWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGP
IYNYRVIISIFFIIYIIIIAFFMMNIFVGFVIVTFQELLSPPTLHFLFRRFRPAXYFVDA
WNTFDALIVVGSVVDIAITEVNPADPTSSPPSSVVRPMGLQNTEDNARISITFFRLFRVM
RLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDHSQIN
RNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSEVGHSSEDCGSHFAIFYFV
SFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDV
VTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGN
LEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQ
GLVAKIPPKTALSLQAGLRTLHDIGPEIRRAISGDLTVEEELERAMKETVCAASEDDIFR
VKRSGGLFGNHVNYYHQSDGHASFPQSFTTQRPLHISKSVSPGEAESPSHQKLVDSTFTP
SSYSSSGSNANINNANNTAIGHRYPKPTVSTVDGHTGPPLTTVPLPRPTWCFPNKRSCFY
DTFMRSDSSDSRLPIIRREEASTDETYDETFLDERDQTMLSMDMLEFQDEESKQLAPMVE
AEVGEERRPWQSPRRRAFLCPTALGRRSSFHLECLRKHNRPDVSQKTALPLHLVHHQALA
VAGLSPLLRRSHSPTLFTRLCSTPPASPSGRGGGGPCYQPVPSLRLEGSGSYEKLNSSMP
SVNCSSWYSDSNGNNSRSVQRTQRPVSLTVPPVTRRNSTSLSHGSAGSLVEAVLISEGLG
RYAQDPSFIQVAKQELADACDMTMEEMENAADNILNANAPPNANGNLLPFMQCRDTGLQE
SRCSHALGLSTATGSDELLGAELERSEVEGQRNSTLKEDEDMECVTSL
NT seq 6267 nt   +upstreamnt  +downstreamnt
atggctagatttgaagttctcgcattcctgcactattcattctctggctccaactattcc
agtccgtcgttggctccagtccccagtctgaatgaggatgagcgtgtggggggcgggggt
ggggtgctgggtcttgcacctgaacacattcccacccctggcgcccccatcagctggcag
gcagccatcgacgcggcacggcaggccaagctgatgggcaccactggagccccgatttcc
actgcgagctccacgcagcgcaaacgccagcactacaccaaacccaagaaacaggccagc
actgcctccacgcgcccaccccgagcccttctctgcctaactcttaaaaaccccatccgc
agggcgtgcatcagtatcgtggaatggaaaccgtttgaaatcataattttgatgactatt
tttgcaaactgtgtggccttagctgtctacatccctttccccgaggacgattccaacgca
accaactcaaacctggaacgggtggagtatctctttctgatcatttttacagtggaagca
tttctgaaagttattgcgtacgggctgctgtgtcaccctaatgcgtacctgcggaacggc
tggaacttgttggatttcatcatcgtggtggttgggctcttcagtgcaatattagagcag
gccactaaaggggatggtgggacttcaatgggaggcaaggctgcagggtttgatgtaaaa
gccctgcgagcctttagagtgttgagacctctgagactcgtatctggagtacctagttta
caggtggtgctgaactccatcattaaagccatggttcccctcctgcacatcgctctgctc
gttctgttcgtcatcatcatttatgccatcattggcctcgagctcttcatgggcaagatg
cacagaacctgttttttcttcaaagatggacacaaaggtcctatatctgaattgaagccg
gccccctgcgccccaaactctgcccatggacgacattgcaccccggccaacataacacag
tgcatgatgggatgggagggcccaaatgatggaatcacgaattttgataactttgcattt
gccatgctgactgtgtttcagtgcatcacgatggagggctggactgacgtcctttactgg
atgcaggatgccatgggttatgagcttccgtgggtctattttgtcagtctggtcatcttt
ggatcctttttcgttctaaatctggttctgggtgtgttgagcggagagttctctaaagag
cgagaaaaggccaaagctcgcggcgatttccagaagctccgtgagaagcagcagctggag
gaagatctaaagggctacctggactggatcacgcaggcagaggatatcgaccctgagaac
gacgacgagggactggacgacgacaagcctagaaatcgtaatatgccggccagtgaaaat
gagtcagtgaacactgataatgctccagctggagacatggagggagagacctgctgtact
cgcatggcaaataggatctccaaatccaaattcagtcgatattcacgccgatggaatcgg
ttatgtcggcgcacgtgccgtgcagcagtgaagtcaaatgtgttctactggctggtgatt
ttcctggtatttttgaacacacttaccattgcctctgagcaccaccagcagccagaatgg
ctcaccaatgtgcaagaaatcgccaataaggtgttgctggctctttttactggtgagatg
ctgctgaagatgtacagcctgggcctacaggcctatttcgtctccctttttaaccgcttt
gacagttttgtggtgtgcggtggaattctggagactatcttggtggaaatcaagatcatg
tcacccctcggcatctctgtgctgcgctgtgtgcgtctgctccgcatcttcaagatcacc
aggtactggaactctctcagtaatctggtggcatctctgctgaactcggtgcgttctatc
gcatccctgcttctgctgctcttcctgttcatcatcatcttcagtctgctcggaatgcag
ctctttggtggcaagttcaactttgatgagacgcgccgcagcaccttcgataacttcccc
cagtctctcctcaccgtctttcagattttgaccggagaggactggaactctgtgatgtat
gatgggatcatggcgtacggtggaccctcctttcctggcatgcttgtctgcatttatttc
atcatcctcttcatctgtggaaactacatcctcctgaatgtcttcttggccattgccgtg
gacaatctggcagacgccgagagtctgacatcagcgcagaaagaggaagaggaggagaaa
gagaggaagaagctggccagaacggccagtcccgagaagcgtcaggactctgagaaacca
cctctggaggatgaaaagaaagaggaaaagattgaactaaaatccatcacttctgatgga
gagacgccaactgccaataagatcaacatagatgagtacacaggggaggagaatgaggag
aagaatccatatcctgtgaacgatttcccagcaggagaggaggatgatgaggagccagag
atgccagtaggtcctcgtccacgtccactctccgacattcagctgaaggagaaagctgtc
cccatgccagaagccaaagctttctttattttcagcgccactaacaagttcagggttttg
tgtcataagattgtaaaccacaacatcttcaccaatttaatcctgttctttatactgctg
agcagtatttcactggcagcggaggacccagtgaataatgactcattcaggaatcagatt
ctaggctatgcagattatgtgtttacaggaatcttcaccatagagatcatattaaagatg
acagcgtatggagcattcctacataagggttcattttgtcggaattattttaattagccg
ttctgattggtggtgccaaactgtgctgtgattcacaggtcaagtgccattaatgtagtg
aagattctcagagtgctgagggtgttgaggcccctgagagcaatcaacagagccaagggc
ctcaaacatgtggtccagtgtgtgtttgtagccatccgtaccatcgggaacatcgtcatc
gtcaccactttgctgcagttcatgtttgcctgtattggtgttcaacttttcaagggcaaa
ttctcctactgcacagacacctctaaacagacacagaccgaatgccgggggtcctatata
ttatacaaacacgggaatgttgggaagccagagaaagcacagcgttcatgggagaacagt
gacttcaactttgatgatgtcctgcagggcatgatggctctgtttgccgtgtccactttt
gagggttggccagggctcctctacagagccatcgactcccatgcagaggatgttggccca
atctacaactaccgtgtgatcatctctatattcttcatcatctacatcatcatcatcgcc
ttcttcatgatgaacatattcgtaggtttcgtcattgtgacatttcaggagctgctgtct
cctccaactcttcatttcctgttccgacgtttccgtccagcannttattttgttgatgca
tggaacacatttgatgcccttattgtagtgggtagtgttgttgatatagccatcacagag
gttaacccagctgaccccacctcctctcccccctcctctgtggtaagaccaatgggcctc
caaaacactgaagataacgccaggatttcaatcacattctttcggctgttccgcgtgatg
aggctggtgaagcttctgtctcggggagagggcattcggacgctgctctggaccttcatt
aaatcctttcaggctcttccctatgttgctttgctgatcgtaatgctgttcttcatctac
gccgtcattgggatgcagatgtttggtaagattgccctgagggaccacagccagatcaac
cgaaacaacaactttcagacgtttcctcaggctgttctgctgctcttcaggtgtgcaaca
ggggaggcatggcaggaaatcatgctggcctgttccccgaaccgcccatgtgagaagggg
tcagaggtcggccattccagtgaagactgtggcagccactttgccatcttctactttgtt
agcttttatatgctttgcgccttcctgatcattaacctctttgtggccgtcatcatggac
aactttgactatttaacacgtgattggtcgatattggggccgcatcacctagatgagttt
aagaggatatgggcagaatacgatcctgaggccaagggtcggataaaacacctggatgtg
gtgacgttactccgcaggattcagcctccccttggatttggaaagctttgtccacataga
gtggcatgcaagcggcttgtgtccatgaacatgcctctcaatagtgacgggacggtgatg
ttcaacgcaactctctttgctctagtacgaacggctctacgcatcaaaactgaaggtaac
ttggagcaagcaaatgaggaactcagagccatcgtgaagaagatctggaagaggacgagc
atgaagctgctggatcaagttgttcccccagctggagatgatgaagtaaccgttgggaag
ttctatgccacattcctgattcaggaatacttcaggaaatttaagaagcgcaaggaacag
ggcctggtggccaaaattcccccaaagactgctctttcactgcaggctggcctgcgcaca
ctgcatgatattggtcctgagatcagaagagcgatatcaggagacctgactgtggaggag
gagctggagagagccatgaaggaaaccgtgtgtgctgcttctgaggatgatatcttcagg
gtaaagcggtctggcggcctcttcggtaaccacgtcaactactaccaccagagtgatggc
cacgcctccttcccacagtccttcacaacacagcggccattgcacatcagtaaatccgtg
agtcccggcgaggcagaatctccctctcatcagaagctcgttgactccaccttcactccg
agcagttactcttcctcaggatccaacgcaaacatcaacaacgccaacaacacagccatc
ggacaccggtaccccaaacctaccgtcagcacagtggatggacacacggggccgcccctc
accactgtcccactaccacggcccacatggtgctttcctaacaagaggagctgtttctat
gacactttcatgcgctctgattccagtgacagtcgtctccctataatacggcgagaggaa
gcatctacagatgagacgtacgatgaaacatttctagatgagagagatcagaccatgctc
tcaatggacatgctggaatttcaggatgaagagagcaagcaattggctccaatggtggag
gcagaggtaggggaagagaggaggccgtggcagtctccacgaagacgggcatttctctgc
cccactgcactgggtcgacggtcttcctttcacttagagtgtttgagaaaacataacaga
cctgatgtttctcagaaaacagcactaccactgcacctagtgcatcatcaggctttggct
gtggcaggtttgagtcccttgctgagacggagtcattctccgacgctgttcacgcgtctg
tgctccacacctcctgcgagtcccagcggccgcggcgggggagggccgtgctaccagccc
gttccgtctctgcggctggagggcagcggatcttacgagaaactcaacagcagcatgccg
tctgtgaactgcagctcgtggtacagtgacagtaacggcaataacagcaggagtgtgcag
aggacgcagcgacccgtgtccctcacggttcctccggtcacacgcagaaactccacatcc
ctgtcacacgggagcgccggcagcctcgtggaggccgtgttgatatccgagggtttgggt
cgctatgcacaggatccttccttcatccaggtagcgaagcaggaactagcggatgcctgc
gacatgacaatggaggagatggagaacgctgccgacaacattctcaacgccaacgcgccg
cccaacgccaacggaaacctgctacccttcatgcagtgcagagacactggcttgcaggag
tcccgttgcagccacgcgctgggcctctcgaccgccacgggctccgacgagctgctgggg
gcggagctagagcgctccgaggtggaggggcagcggaacagcactctgaaggaggatgag
gacatggagtgcgtgaccagtttgtag

DBGET integrated database retrieval system