KEGG   Sinocyclocheilus anshuiensis: 107694176Help
Entry
107694176         CDS       T04917                                 

Definition
(RefSeq) N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D-like isoform X1
  KO
K13985  N-acyl-phosphatidylethanolamine-hydrolysing phospholipase D [EC:3.1.4.54]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.54  N-acetylphosphatidylethanolamine-hydrolysing phospholipase D
     107694176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B_3 Lactamase_B
Motif
Other DBs
NCBI-GeneID: 107694176
NCBI-ProteinID: XP_016349283
LinkDB All DBs
Position
Unknown
AA seq 404 aa AA seqDB search
MAALTSALLVMRPRALATDSSLLLALAGLTQRCLCSSVAGGASMAEEPLVTAGNNFPLDY
RQEQDVTCSRRDSHGCFVNPWTTWQFPSYSTIARLFLTEKNNSNVPSAKEVLDCELPIQE
PYFVQRPDQCGQTGPSVRATWLGHATVLVEMEGLVFLTDPMFSQRASPVAFMGPKRYRDP
PCTIEQLPRLDAVVISHTHYDHLDADSVAALNARFGSSLRWFVPLGLAEWMQKAGCENVT
ELDWWVGNRIPGHDNVTFFCTPAQHWCKRTPVDDNKALWGSWTVVGPHCRFFFAGDTGYC
LAFKEIGKRFGPFDLAAIPIGAYLPRGIMKSQHVDPEEAVQIHMDIQAKTSLAIHWGTFA
LAYEHYLDPPACLREAMVNHGLNPDLFFILHHGESRKINHKDTS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccgctcttacatcagctcttctagtgatgcgccctcgtgcgctcgcgacagactcg
agtttgctgctggcactggcaggactgacgcagcggtgtttgtgtagttcagtggctggt
ggggcgtccatggcagaggaacctttagtcaccgcagggaataacttcccactggattac
aggcaagagcaagatgttacgtgttccagacgggactctcatgggtgctttgtgaacccc
tggacaacatggcagttcccctcctacagcaccatcgctcgcctgttcctcacagagaag
aacaacagtaatgttcccagtgccaaagaggttcttgactgtgagttgccgattcaggag
ccatatttcgtgcagaggccagaccagtgtgggcagacaggcccatctgtgagagcgacc
tggctgggtcatgccactgtactggtggagatggaaggactggtgtttctgactgacccc
atgttcagccagagagcctctccagtggcattcatgggcccaaagcgttaccgtgacccg
ccttgcaccatagaacagcttcctcgcctggacgcagtggtgatcagtcacacacactac
gatcacctcgacgcagactctgtggcagctctgaacgctcgcttcggttccagtttgcgc
tggtttgtgccgctcgggttggccgaatggatgcagaaggcaggctgtgagaatgtcaca
gagctggactggtgggtaggaaaccgcattcccgggcacgacaatgtcacattcttttgc
acaccagcacagcactggtgcaaacgcactcctgtggatgacaacaaagcattatgggga
agctggacagtcgtaggcccacattgtcgtttcttcttcgctggagatacgggatactgt
ttggcatttaaagagattggaaaacgcttcggaccattcgacctggctgccatcccgatt
ggagcatacctgcccagaggaatcatgaagtctcagcatgtggaccctgaagaggctgtt
cagattcacatggacattcaggccaaaacatcgctggccattcactgggggacgtttgct
ttagcctatgagcattatcttgaccctccagcatgtttgcgtgaggctatggtgaatcat
ggattgaatccagatctgttcttcattcttcatcacggagagtcacggaagatcaaccac
aaggacacatcctaa

DBGET integrated database retrieval system