KEGG   Sinocyclocheilus anshuiensis: 107695625
Entry
107695625         CDS       T04917                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
sanh  Sinocyclocheilus anshuiensis
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 Ras_bdg_2 C1_2
Other DBs
NCBI-GeneID: 107695625
NCBI-ProteinID: XP_016351121
UniProt: A0A671T3I2
LinkDB
Position
Unknown
AA seq 363 aa
MAKCELIEVQDLTPDDRIELAPPSGPPARDGPTLERWSKEKVVRMVGERVRLEDPDWLTC
KPGWGHDFQPCSQTQLSWCDLCGEFIWGLYRQSLRCTHCNYTCHYRCQPFIQLDCSLNCD
AVSKQLNYCEDTIETDTNVDEPVDCKKQELSLSEIQQKMKEYNAQVNSNLFMVLNRDGSY
TGFIKVQFKLARPVSLPPPRSTSSSSSSGRDGGCQEDKTLKHRTSFYLPRDTVKHLHISS
STRAREVIEALLKKFTVVDNPAKFSLFERSERQNQVYLRKLADDEHPLFLRLCAGPNEKV
LSLVLKENETGEVNWDAFSFPELQNFLRILKREEEDHVRQIVRRYTLARDKMKEALKNFS
TPG
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggcaaaatgtgagctcattgaagtgcaggacttgactccagatgaccgcatcgagtta
gcgccccctagcggccctccggcccgcgatgggcccactctagaaaggtggagcaaagag
aaggtggtgcggatggtgggggagcgcgtgcgtctggaggaccccgactggctgacgtgt
aaaccgggatggggacacgacttccagccctgcagccagacgcagctgagctggtgcgac
ctctgcggagagttcatctggggcctgtaccgccagagcctccgctgcacacactgtaat
tacacttgtcactaccgctgtcaacccttcattcaactggactgcagtttgaactgcgac
gccgtcagcaaacagctaaactactgcgaggacacgatcgagacggacactaatgtggat
gagccagtggactgcaagaaacaggagctgtccctcagtgaaatacaacagaaaatgaaa
gaatacaatgctcaggtcaacagtaacctcttcatggttctgaaccgtgatggatcttac
actggcttcataaaggtccagttcaagctggcccggcccgtgtctctccctcctccacgg
agcacgtcctcctcctcctcctcgggacgggatggcggttgtcaggaagacaaaacactg
aagcaccgcacctcattctacctgcccagagacacggtcaaacacctgcacatcagctcc
agcacgcgggccagagaggtcatcgaagccctgctgaagaaattcactgtggtggacaat
ccggccaagttctcactgtttgaacgcagtgaacgacagaatcaagtgtacttaaggaag
ttagcagatgacgaacatccgcttttcctgcgcctgtgtgctggacccaatgagaaagtc
ctcagtttagtccttaaagagaatgaaacgggggaagttaattgggatgcgttcagtttt
cctgaactccagaacttcctgcgcatcctgaagcgggaggaggaggatcacgtgcggcag
atcgtgcggcgctacactctggccagagacaagatgaaagaagctctgaagaacttcagc
acgccgggctga

DBGET integrated database retrieval system