KEGG   Sinocyclocheilus anshuiensis: 107695802Help
Entry
107695802         CDS       T04917                                 

Definition
(RefSeq) histone-lysine N-methyltransferase 2D-like isoform X1
  KO
K09187  histone-lysine N-methyltransferase MLL2 [EC:2.1.1.43]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107695802
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sanh03000]
    107695802
   03036 Chromosome and associated proteins [BR:sanh03036]
    107695802
Enzymes [BR:sanh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107695802
Transcription factors [BR:sanh03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    107695802
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107695802
   HMT complexes
    MLL-HCF complex
     107695802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD FYRC FYRN SET zf-HC5HC2H zf-HC5HC2H_2 HMG_box
Motif
Other DBs
NCBI-GeneID: 107695802
NCBI-ProteinID: XP_016351337
LinkDB All DBs
Position
Unknown
AA seq 4998 aa AA seqDB search
MDEQKSNCEENDSETAADDGTSAKESIQFEGELSAPVAAEDISGTTVDTSSSSLETVRAC
ALCNCVERSLHGQQELRCFAPSSDRPRLEPSVSSLPAAGNDDLSSIGFSESTCLASLFDD
TGSCWVHHWCAVWSEGVEQTEGEVLINVDKAVISGIQRPCYYCKRMGATIRCRAEGCSRF
YHFPCSAASGSFQSMKQLALLCPEHIDKAEEIAGEEARCAVCDSIGELSGLLYCTGCGQH
YHDACLEISATPLQRSGWQCPECKVCQTCRQPGEDSKMLVCDACDKGYHTFCLLPAIDSV
PPDSWKCKRCRVCIDCGMRGLKLPGSEQWFESYTVCEGCQRRRTSVCGVCSKATEPSVSL
QHRCAICHRWIHSDCASLSGPPEEKCICVLCKEIPDEVLIESEVLSTQEDEKADLEVPME
LGTELEVVETAEVKESITEEELRPEGAEGSTETNAHSEVSTEQQATLATVSDVDEKQKEE
TTTIEAVVTEAIVEKSEDTQDPPVKDSPDSPVPDTIEEAQSDVAETNIERQEESQGQDNT
PQTEMESICTEETTETNPPTSSCSQSSQITLPVLEEAEPVVMDLEEVGSNARQEEAIHRT
PLPAPQTEMPPASDTDDIMVQSEDEEEEDEQGVEESLEESLLKDESPGEDDQSRKEMQED
MKPELVLDETSNISHGDESSSGFLGSPAEADSQMLSMELSLMPASRTRSDSLLTETEDLL
PFDPLKPDGDKVKRRGSPGRSRVKQGRGSGFPGKRRPRGGGSSSSGGRGRGRSRLKAMAS
CIDAFLQTMTADTGLSKEEDEEEDDTMQNTVVLFSNTDKFVLQQDMCVVCGSFGQGVEGQ
LLACAQCAQCYHPYCVNSKITKMMLRKGWRCLECIVCEVCGKASDPARLLLCDDCDVSYH
TYCLDPPLQTVPKGGWKCKWCVCCMQCGASSPGFQCEWQNNYNHCGPCASLVTCPVCREN
FMEEELLLQCQHCDRWVHAVCESLYTEDEVEQASDEGFACTACTPYVPRPVVESPMMSAF
KMKEPEPQFYRLEGVWLTETGMSLLRSMSMSPLHKRRQRRSRLGTMCIDELKEGDADGDE
GKGGAEAMECEPKLEAPGSPDREGGVDRETGADGGVEGMADCETLKGGVEETEDGKKRKR
KPYRPGIGGFMVRQRKCHTRMRRSLSASGDGVPEGQAAEMKLEEGPHPDIPLDVPEAKTA
EGEGEQAKKRRGRKKSKLEDMFPAYLQEAFFGKTLLDQSKRAFLAPPTQRHTQGILKPPL
PGHGARNTASEPVEATTRLTGLHVELKQEGEGSKPPGDRAAEGQGASGQLSNKDQSSGDT
HGSDVQKNEDLPQGLEGQDSRQFFQKVLGPTEGSATSGPLQPSIKPVQEGDSNQSSCLQR
NLLGASLSGALPSTGMMDSFSGLSQSPFFDIRDRGGLFSPDQDEESPWATPSTPATPSTP
PTPTEQEGDGLSYNQRSLQRWEKDEELGNLSTISPVLYANMNFPSLKQDYPDWPSRCKQI
MKIWRKVSAADKVPYLQKAKDNRAAQRINKAQKQAESQVCRPIKTEPGRIKGERPNLHLQ
IPPPSGSVSTPSQPSSAESPYPLAPDSASSAFFSDGPLKTPCSAYAQTDPFSKLASQSPH
FQSQPSTPYSQPSSSPLSASSSGYPMPGPQGATQGRPASFGSLDMQPGTPRRAQQVDPFF
KPQQQIPKPQQPSQEALGPPESPRPRTGGPGDSQMFSPPHTTHCGDPYRGQHGASRQDHV
SSPSPSVIPSSPAGVGPNRAEINAPSPRSSFGRQDLSSGSPASLDSGDGLFKAPMTPRMH
QGDAGGLSVSHPSGASPNHPPESYRQSPSTFSDPYSQPPLTPRPQSGDGSSPLPQRLPAP
QQETYSRLPSSPQSQGSSQSPLTPGTISNDVLSVQSPATPRFQSPDPYSRPPSRPQSRDS
FASLHKPPRPSSVAPEGNSPFRGSPHSSQQPPCSPSVADPLSGKPPFSCSPGVGFQMGQQ
QVVGQQQMMTPQQAQVHLPQPQSQTQPVGAEFNSRIALPPGNQDTAVRATDAPHLPNLPG
VQDMSDLSAGQDPALMNLSPSELEKHRQRQRLREFLIRQKMQRNSLRQEKEAPVVGNPAP
SWPGGEMPAFQQDKSQRAPPPYPQDRAVVAQAALATRMPPPVGAMDEKLCRPPPSGTPAT
MDPSALRQAGPNISQGMYSRPPYPAQWQNQGAPRRFPQPSMMEAVPRQHLNTPINNPLNI
QSMPNMPNPLTGVPGTGTEAVRSHVSGAPPQFIELRHNLQRMPLGSQFMQRVPIPRPRMF
LPQQEMNAAFVQQNLHPSLDASAEGMRGPRIGLQPGGMNLLMQQQSNVPPSQSQLQPQQV
PTTTPKTPISHTTTQQLPQTSTIRGQRTVVNPVDLPESDLGLGDTVAETGVEDDDLATLD
LDPDKGDDDLGNLDNLETNDPHLDDLLNSDEFDLLAYTDPELDQGDPKDVFSDQLRLVEA
EGEGPGSSANVEIKVEEKPKVDIASKDTHTTATQPPLKTESSSTSTPKVESSDAIRLSSV
KLEDKGLIEQPQSGQAPVKDDISATVSVLLSGTKASNQPETATASLNTVRLGGIPYPLPS
QSFPPTAPHPDLGDDPLGLPDAGHHSTADDLDKVESSLEASELPLLIQDLLEHEKKELQK
QQQQQQQLGALQGGIASQLHGIQNQQQPPQGPNQIMMPQHHHPSQGIVPQAGMVPRPPHM
LPQQQQRLIGAAVPSPPHAAMGQPQGVLRGVQPGRIHPGLTPQQQTATPTHIVKQQNLAS
NFLPDKDLEKLVTDDIMDPIAKAKMVALKGIKRVLAQDPMGVPPGMNRQQVSLLAQRLTS
APGNEDSQAQFAPGSSKEGEGSNQVQTRPNPPQFGIINDAEQHQYEEWLVHTQQLLQMQL
KFLEEQIGAHRKSRKALCAKQRTAKKAGREFAEADAEKLKLVTEEQSKIQKQLDQVRKQQ
KEHTNLIAEYRSKQQQHQQGSSILAPGPSTQAPHMLSKMPGQMIMGQQGGPIIGQPPGGM
PQVGVPQGGMPVRMPQMQPFGGAQPSLPLGAGTVQPVPPPGFFQQAPGAQGPDPRVIQER
QLQQRMQMVQKMQQQQQQQLMMGQQPMSHQPQQPGIVNQQPGAMGNQPTQVLVVNMGQQQ
TNLQQGLMNNQQNQQGLMQTTPGMMGNQVIGQMQHNVLGQPVTQNVNIMAGHPQGGMVGN
QQIVQQLQRPQGLMDQHGPGGQHDVRGPPAQLTSQQQSVMAQRILMSQQQQNAAKNLAQL
QQQQISQLKQPTQVGPSEPQRALETPPSGSTQGVAENLQQGVQDLQNPDRKDGGLLSPKT
PPQQGGPPTPLQMQQHGSSGEQKCGVGQPQQPHAFLGQQQTAQPQSNQNIGVAEQHGFVG
NQQAGSHLKVQPQQQQIQLGLQTQNTIQIKQEDQQMCFMAQQQAGQIAAQQPQDMLGQNS
GQTQSTMAGISNQHQQALLTQQMGISRGQQMMMTPRPGAPAGQIRAPINIQTFIAQNPQL
RHLTPSQQLQQIQAMIAQRQLQQGQMLRMQGQVQGQMRPQVPQGPPVGTRMPGLEIQQQQ
HRFALVGKHGPAGAQQQSGTMGQLPGMAPQFHQSVSGAMQQPSQGSLPQYINSAQQQQML
QQQQVHQHQMMRGQVPRPVMGQVRATAPGHMARPMSPRQLVGQGSPGSPLSNPQRLMRMS
QTPPGPQHLQQQQSHVATALSPFQASPSHVGSPAGSSVPEPGSSPASAHKPEPGTLSFSS
HLSSPSRPDSVVGKSSPFSQTGGSIASPMRSPAAKTQSPNTETLSAPFPLNGPSPQLAQN
PHQATTAAQVSDGHMSKPTQLLSEMTLQNIKQEPREVQCDTGGSVEAHSDGIKREISGET
VSAIAIANCAILGSRNQAGDLGSQIQRTETGQQLLQKLLRTKNVQMASQRPSDGIHNEIN
GHINSKLAMLEQKLQGTPRNMEDLQSLTKRTPIVKAKRTTKAGERGPNSRKKTKKEEVGK
TEAIMKQLKQGLSLLPLMEPSIAASLDFFAPFGSSPANAKAQLKGSFGNAMLDNIPDYYS
QLLTKNNLSNPPTPPSSLPPTPPPSVQHKLLNGVTLAEGQKETEASEDTMGSVPEEVKSV
DILAALPTPPHNQNEDIRMESDDDSDAPDSVVPASSPESQLGDETTRFPHLLDPKEEEDE
RAISPVIPIIPRSAIPSFPETKPFESVDGKVVASSSQWDKTKNNEVSVTFMLSSAAAKNI
NTVMLAVAQLLHIRMPSSYEAAFPQSPGRAGVGPGKVPDTSNPGMKADTSASHDAEWLKQ
FDVSLPGCTLRKQVDILALIKQECQEQEDRPAQHCYMTNVSDLDVRHLPVIPVEVSPPPS
PSPPPPPSSAVAEPENITQPEPKPEPDAPVQTTSSPSASPSAPAKTESIVKLESHSSPVT
VESESQEPVVLPQAAPSEEEQPPAPASSPLLDSPTMEISLKPIKHRSRPLSDEEEERPKV
KKWKGLRWKRLQIVITIRKGGSKKENSREVSELMERLRITLKPDKMPRDKRKCCFCHEEG
DGATDGPARLLNIDVDLWVHLNCALWSTEVYETQGGALINVEVALRRGLRTRCAYCQKTG
ATNSCNRLRCPNVYHFACAIRARCMFFKDKTMLCTQHKLKGPSEEELSSFAVFRRVYIER
DEVKQIASILQRGDRIHMFRVGGLIFHAVGQLLPCQMVVFHSPTAIFPVGYEATRIYWST
RVPNRRCRYRCRISEQDGRPLFEVRVLEHGYEDLHFRDTTPDGIWSKIVQQVAKLRDEAA
MLKLFTEHVKGEEMYGLTVHAVMRITESLPGVENCQNYTFRYGRHPLMELPLMINPTGCA
RSEPRVLTHCKRPHTLNSTSMSKAYQSTFTGEINTPYSKQFVHSKSSQYRRLKTEWKNNV
YLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEH
VIDATLTGGPARYVNHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDD
QHKIPCHCGAWNCRKWMN
NT seq 14997 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcagaaatcaaactgcgaagaaaatgattcagaaactgcagctgatgatggg
acctctgcaaaggagagcatccaatttgagggggaactgagtgcccctgttgctgcagag
gacatctcaggcactactgtggacacttccagctcatcattagaaactgtcagggcttgt
gctctgtgtaactgtgtggagcgtagtctgcatggacagcaggagctccggtgttttgca
ccctcttccgatcggcccagattggagccctctgtctcctctttgccagcagctggaaat
gatgacctgtcttccattggattctctgaatccacctgtctggcatctctctttgatgac
acggggagctgctgggttcaccactggtgtgccgtgtggtctgagggagttgagcagact
gagggtgaggtgctgataaacgtggataaggcagtcatctcagggatacagcggccatgt
tattattgtaaacggatgggtgctaccatccggtgccgggccgaaggctgctcacggttc
taccacttcccctgctcagctgcgagtggatcattccagtccatgaagcagctggcgctc
ctctgtccagagcacatagacaaggctgaggagattgccggagaggaagcacggtgtgca
gtgtgcgactccattggggaactgtcaggtctgctatactgtacgggctgtgggcagcac
tatcatgatgcctgtcttgagatcagtgccacaccacttcagcggtcaggttggcagtgt
cctgagtgcaaggtgtgccagacctgcaggcaaccaggggaggattcgaagatgctggtt
tgtgatgcttgtgacaagggctaccacaccttctgtctactgccagccatagactctgtg
ccccctgattcatggaagtgcaaacggtgccgtgtgtgtattgactgtggcatgcgaggg
ctaaagcttcctggctctgaacagtggtttgagagctacacagtatgcgagggctgccag
cgcaggcgcacctctgtctgtggcgtgtgcagtaaggccacggagccctcggtctccctg
caacatcgctgtgccatctgccacagatggatacacagtgattgtgcctctctgtcaggg
cctcctgaggagaaatgcatctgtgtgctctgcaaagaaatcccagatgaggttctgatc
gagtctgaggtgttatcgacgcaagaagatgagaaagctgatttagaggtgccaatggaa
ttagggacagagcttgaggtggttgaaacggcagaagtgaaagaaagcattacggaggag
gaactacggccagaaggtgctgagggctccacagagactaatgcgcacagtgaggtctct
acagagcagcaggccactttagctacggtttcagacgttgatgaaaaacaaaaagaggag
acaactaccattgaagcagtggttacagaggccattgtggaaaaatcagaggatactcag
gaccctcctgtgaaggatagcccagatagtcctgtaccggacactatagaggaagcccaa
tctgatgttgctgaaactaacatagaaaggcaggaggagtcgcaagggcaagacaatact
cctcagacagagatggagtcaatctgcacagaggagactacagaaacaaaccctccaaca
agctcatgttctcagtcttctcaaatcacactccctgttttggaagaagcagagccagtt
gttatggacttggaggaggtgggatctaacgcacggcaagaggaggcgatacaccggact
cctctccctgctcctcagacagaaatgccccctgcatctgacactgatgatataatggtc
cagtctgaggatgaagaagaggaggatgagcagggggtggaggaatccttagaggagtcg
ctcctcaaagatgagagtccgggagaagatgaccagtccaggaaagagatgcaagaggat
atgaagccggagctggtcctcgatgagacatcaaacattagccatggtgacgagagcagc
agcggtttcctcggctcgccggctgaggcagactctcagatgctgtccatggaactcagc
ctgatgccagccagcaggacccgttctgattcgctgctaaccgaaacggaggacttgttg
ccttttgatccactgaagcccgatggagataaagtgaagcgcaggggttctccaggacgc
tcacgggtaaagcagggcagaggcagtggtttcccagggaagcggcggccacgtggtggc
ggcagcagcagtagtggtggaagagggcgtggacggtcacgtctcaaagcaatggcctct
tgcattgatgcctttctacaaaccatgacagcggacactggacttagcaaagaagaagat
gaggaggaagatgacaccatgcaaaatactgtggtacttttctccaacactgataagttt
gtcctgcagcaggacatgtgtgtagtgtgtggtagttttggacagggtgtggagggccag
cttctagcctgtgctcagtgtgcacaatgttatcatccatactgtgtgaacagcaagatc
accaagatgatgttgagaaaaggctggcgttgtctcgagtgcattgtgtgcgaggtgtgt
gggaaggcttcagaccctgcccgtttgctgctttgtgatgactgtgatgtcagctatcac
acttattgcttggacccacccttacagactgtgcccaagggaggctggaagtgcaaatgg
tgtgtgtgctgtatgcagtgtggtgctagctcccctgggttccaatgtgagtggcaaaat
aactacaatcactgcggcccttgtgccagcctggtaacctgtcctgtgtgtcgtgagaac
ttcatggaagaggagctgcttctgcagtgccagcactgtgacagatgggttcatgctgta
tgtgagagtctttacactgaggatgaggttgaacaagcatctgatgagggctttgcctgt
acagcctgcactccatatgtccccaggcctgttgtggagtctcctatgatgtcagccttc
aaaatgaaagaaccagagccacaattttatcgtctggagggagtctggctaacagagact
ggcatgtctttattgcgaagcatgtccatgtcacccctgcacaagcgcagacagcgccgg
tcccgactgggcaccatgtgtattgatgagttgaaagaaggcgatgcagatggtgatgag
gggaaaggaggtgcagaagcgatggaatgtgagcccaagctagaagcccctgggagccca
gatagggaaggaggagtagacagagaaactggggcagatggaggtgtagagggcatggct
gactgtgaaactctcaaaggaggagtagaggagactgaagacgggaagaagagaaagcgt
aaaccatacagaccagggattggagggttcatggtccggcaaagaaagtgtcacacacga
atgaggaggagtctgtctgcctctggtgatggtgttcctgaaggtcaagcagctgaaatg
aaacttgaggaaggacctcatcctgacatacctctcgatgtcccagaggcaaaaacagca
gagggagagggtgagcaagccaagaagcgcaggggcagaaagaagagtaagttggaggac
atgtttcctgcatacctacaggaggctttctttggcaagacattactcgatcagagtaag
agagcttttcttgctcctccaacccaaagacatacgcagggcattctaaaacctccactc
cctgggcatggtgccagaaatacagcttctgaaccagttgaggccacaaccaggctgact
ggtctgcatgtggaactaaagcaagagggtgagggatccaagcctccaggagatcgagca
gcagaagggcaaggagcaagtgggcaactttccaacaaagatcagagctcaggagataca
catgggtctgatgtacagaagaatgaagatctccctcagggactagaaggtcaagactct
cggcaatttttccagaaagtacttggacccactgagggaagcgccacaagtgggcctctg
cagcctagcattaagcctgttcaagagggtgattcaaatcaaagtagctgccttcaaaga
aaccttcttggtgcttccttatctggcgcactcccctcaactggtatgatggactctttt
tctggtctctcccagtcccccttttttgacatacgtgatcgaggtggtcttttcagtcca
gaccaggatgaggaaagcccatgggcaacaccatccactccagccaccccttccactcct
ccaactcctactgaacaggaaggtgatggcctctcctacaatcagcgcagtctgcagcgt
tgggagaaggatgaggaattgggaaatctatctaccatctctcctgtactatatgctaac
atgaacttcccaagtctcaaacaggactaccctgactggcccagtcgctgtaaacaaata
atgaagatttggaggaaggtatcagctgcagacaaggttccttatctgcaaaaggccaaa
gataatagggctgctcagagaataaacaaggcacagaagcaggctgaaagtcaagtatgt
cgccctatcaaaactgagcctggccgtattaaaggcgagcgccctaatctgcacctccaa
attcccccaccatcaggctccgtatccactccctcccagccgagctctgctgagagtcct
taccctcttgctcctgactctgcatcttcagcctttttttctgatggacccctcaagact
ccttgctcagcttatgcgcagacagacccattttctaaacttgcctctcagtctccgcac
tttcagtctcagccatccaccccatactcacagccttcttccagccccttgtcagcctct
tcctcaggatatcctatgcctggcccacagggtgctactcagggacggccagccagcttt
ggctcccttgacatgcaaccagggactcctcgcagggcccagcaggttgacccatttttt
aaaccacaacagcagatccccaaacctcagcagccctctcaggaggccttaggtccacct
gagagtcctcgacctaggactggtgggcctggagactcgcagatgttctcaccgcctcat
acaacccattgtggtgacccttaccgtggccagcatggagctagccgacaagatcatgtt
tcgtctccatcaccgtctgtaataccttcttcacctgctggggtgggcccaaatagggca
gaaattaatgccccatctccacgctcttcttttggccggcaagacctaagctctggttct
cctgctagtttggactctggagatgggttattcaaagcccccatgacccctcgtatgcat
cagggggatgcaggtgggttgtctgtttcacacccttcaggtgcctctcctaatcatcct
cctgagagctaccgccaatctccctctacgttctctgacccttactcccagcctcctctc
acaccgcgacctcaatcaggtgacggatcttctcctctaccccagagacttcctgcgcct
cagcaagaaacatattcaagattaccttccagccctcaatcgcaaggcagttctcaatcg
cctctcacaccaggaaccatttccaatgatgtgctttctgtgcagtcaccagccactcca
cgcttccagtcacctgacccttactcccgtccaccttcacgacctcagtccagagattcc
ttcgcttcattgcataaacccccccgcccatcttctgtagcaccagaaggtaactccccc
tttagaggttcacctcattctagccagcaacccccctgctcaccctcagtagccgatccg
ctctctggaaaacccccatttagctgcagtcctggtgtagggtttcaaatgggccagcaa
caagtagttggccagcagcagatgatgactcctcagcaagctcaggtccacctcccacag
ccacagtcccagacacaaccagtgggtgctgaatttaactcgagaatagcacttccacct
ggaaaccaagatacagctgtgagggcaacagatgctccacatttacccaacttgccaggg
gtgcaggatatgtcagacctgtcggctggacaggatccagctctcatgaaccttagtcca
tcagagttagaaaagcacagacagaggcaacgattgagagagtttttgataagacaaaaa
atgcagagaaactcacttcgccaagagaaggaagcacccgtggtgggtaatcctgctccg
agttggccaggcggggaaatgccggcctttcagcaagacaaaagccagcgagcaccacct
ccttaccctcaggacagagctgtggttgctcaggcagcccttgccaccaggatgcctccg
ccagtgggagcaatggatgaaaagctttgccgcccacctccttctgggacaccagcaact
atggaccccagtgcattaaggcaagctgggcccaatatttctcaggggatgtattctcgt
ccaccatatcctgcacagtggcaaaaccaaggtgctccgcggaggttcccacaaccatct
atgatggaagctgttcccaggcagcaccttaatactcccatcaacaatcctctcaacatt
cagtccatgccgaatatgcccaatcctttgacaggggttccaggcactggcacagaggct
gtacgaagccatgtgtcgggagctccacctcagtttatagagctgaggcataatttacag
aggatgccactgggctctcagtttatgcaaagggtgcctatacctagacctcgcatgttt
cttccacagcaggaaatgaatgctgcttttgttcagcagaatttacacccatctctggat
gcttcagcggagggaatgcgtggtcccagaattgggttacagccgggtggcatgaaccta
ctgatgcaacaacaaagcaatgtacccccttctcagtctcaactacagccgcagcaggtg
ccaactactacacccaaaactcccatttctcacactactactcaacagcttcctcaaaca
agtacaataagaggtcagcggactgttgtgaatccagttgacctgcctgagtctgaccta
gggctaggtgatacagtggcagaaactggagtggaggatgatgatcttgctactcttgac
ctggatcctgataaaggtgatgatgatttgggaaaccttgacaatcttgagaccaatgat
cctcatttggatgatctgctcaacagtgatgaatttgatttgctggcttacactgaccct
gagcttgatcagggtgatcccaaagatgttttctctgaccagttgcgacttgtagaagca
gagggagaaggaccagggtcttctgctaatgtagaaatcaaggtggaagagaaaccaaaa
gtggatatagcttccaaggacacgcacacaactgccactcaaccacctttaaagactgag
agttcatctaccagtactccaaaggtagagtcttctgatgccattaggctatcctctgtc
aaacttgaagacaagggattgattgaacaaccacagtcaggacaagctccagttaaagat
gacattagtgcaactgtgtctgttttgctcagtggaacaaaagcctctaatcaaccagag
actgcaactgcttctttgaacaccgtccgtttaggtggtataccttatcctcttcccagc
cagtcttttccaccaactgcaccacatccggacctgggtgatgatccacttggattgcca
gatgctggccaccactctacagcagatgatcttgacaaagtagaaagctcactggaagcg
agtgaactacctttgttaatacaagaccttttggagcatgaaaagaaggagctacagaaa
caacaacaacagcagcagcagttaggtgctctacaaggagggattgctagtcaacttcac
ggcattcagaatcagcaacagcctcctcaagggccaaatcaaattatgatgccacagcac
caccatccatcccaaggcatagtgcctcaagcaggtatggtgcccaggccacctcacatg
ttaccacaacagcagcagaggttaattggtgctgcagtgccttcacctccccatgcagca
atgggacaaccgcaaggtgttttacggggtgtgcagcctggtagaattcatcctggtctt
actccacagcagcagacagcaacacctacacatattgtcaaacagcagaacttggccagc
aactttttaccagataaagatctggaaaaattagtgacagatgacataatggatcctatt
gcaaaggctaaaatggttgcgctgaaaggaattaaaagagtgttggctcaagatcctatg
ggtgtaccaccaggaatgaataggcaacaagtatctcttttggctcagaggctaacctca
gcccctggaaatgaggattcccaggctcagtttgcacctgggtcttccaaggaaggagaa
ggtagcaaccaggttcaaacaagaccaaatcctccgcaatttggcatcatcaatgatgct
gagcaacaccaatatgaagaatggcttgtgcacacccagcagttgctgcaaatgcagttg
aagttcttagaagagcaaattggagcacatcgtaaatcccgtaaagctctgtgtgccaag
cagcgtactgcaaagaaagctggacgtgaatttgcagaagcagatgctgaaaaactcaaa
ctcgtcactgaggaacaaagtaagatccagaaacagttggaccaggtgcgtaaacagcaa
aaggagcacaccaatcttattgcagagtaccgaagcaaacaacagcagcatcagcaaggg
tcttccatactagctcctgggccctctacacaggcgccccacatgctttccaaaatgcct
ggacaaatgattatgggccaacaaggaggtccaattattggtcagccacctggaggaatg
cctcaagtaggggtgcctcagggagggatgccagttagaatgccacaaatgcaacctttt
ggtggagcccagccttctctcccactcggagctggcactgtgcaaccagtcccacctcct
ggttttttccaacaagcccctggagcacaaggaccagatccaagagtcatacaggagcga
cagttacagcaaagaatgcagatggtccaaaaaatgcagcagcagcaacaacaacagttg
atgatggggcagcagcctatgtcgcatcaacctcagcagcctggcatagtgaatcaacag
cctggagccatgggcaaccagccaacccaagttttggtggtcaatatgggccagcagcaa
acaaacttacaacaaggattaatgaataaccagcaaaatcagcaggggttaatgcaaacg
actccaggtatgatgggaaaccaggttattgggcagatgcaacataatgtcttgggccag
ccagtgactcaaaatgtaaatataatggcaggacatccacaggggggtatggttggtaat
caacaaattgttcagcagcttcagagacctcagggtttgatggatcaacatgggccgggt
ggacagcatgatgttagggggccaccagcccaactcacgtctcaacagcagagtgtaatg
gctcagcgcatactcatgtcacaacagcaacagaatgctgcaaaaaaccttgctcaactt
cagcagcaacaaatttcacaactgaaacaaccaacgcaggttgggccctctgagccacaa
agagctttagaaactccaccatcggggagtacccaaggggttgctgagaacttacagcaa
ggtgtccaagatcttcaaaatcctgaccgtaaagatggaggactacttagtccaaaaaca
cccccccagcagggtggacctcctacaccacttcagatgcaacaacatggatctagtgga
gagcagaaatgtggtgttggacagccacagcaaccacatgcttttctgggtcaacaacag
acagcacagcctcaatcaaaccagaatatcggagtagcagaacaacatggttttgtgggc
aaccaacaggctggatctcatcttaaagtacaaccacagcaacaacagattcaacttggt
cttcagacccagaacaccatacaaataaaacaggaagatcagcaaatgtgctttatggca
caacagcaagctggtcagattgctgcacaacaaccacaggatatgcttggccaaaatagt
ggtcagactcaaagtacaatggccggcatttcaaatcaacatcagcaagctctcttgact
caacagatgggcatttctagaggccagcagatgatgatgactccaaggcctggtgctccg
gcagggcaaatacgtgcccctattaacattcagaccttcattgctcagaacccccaactg
cgtcacctgactcctagccaacagttgcagcaaattcaggcaatgattgctcagcgacag
ctacaacaaggccagatgctaagaatgcaaggtcaggttcagggacaaatgcgtccccag
gtcccacaggggcctccagttggtacacggatgccaggtcttgaaatccaacaacagcag
caccgctttgcattagtaggcaaacacggtccagctggcgctcaacagcaatcaggaaca
atgggacaattacctggtatggctccacagtttcatcaaagtgtttcaggggctatgcaa
cagccttctcaaggatctttgcctcagtacatcaatagtgcccagcagcagcagatgcta
caacagcaacaagtacatcagcatcagatgatgaggggtcaagtacccaggccagtaatg
ggtcaagttcgtgccacggcacctggacatatggctagaccaatgtctcctcgtcagtta
gtgggtcagggttctcctggaagcccgctttctaatccgcaaaggctcatgagaatgtct
cagactccaccaggcccccaacaccttcagcaacaacaatcccatgtggcaacggcactg
agcccctttcaagcctctccctctcatgtgggttctcctgcagggtcttctgttccagaa
cctggttcaagcccagcatctgcacataaacctgagccaggcaccctgtctttctccagt
cacttgtcatcgccttctaggccagatagtgttgtaggaaagagtagcccctttagccag
acagggggatcaatagcttcacctatgagatctccagctgccaagactcagagccccaac
actgaaactctttcagctccttttccactcaatggtccgtctcctcagttggcacagaac
ccacaccaagcaacaactgctgctcaagtatctgacggtcatatgtctaaaccaactcaa
ctgcttagtgaaatgacactgcaaaacatcaaacaggaaccacgtgaagtccagtgtgac
acaggaggtagtgtagaggcccattctgatggcataaagagagaaatttctggagagaca
gtcagtgccattgctattgcaaactgtgctattctgggctctagaaatcaagcaggagat
ctcggatcccaaattcaaaggacagagactggccaacagcttctgcagaaactccttcga
accaaaaacgtacaaatggcttctcagaggccctcagatggcattcataatgagataaat
gggcacatcaatagcaaactggcaatgctggagcagaagcttcaaggaacaccgcgaaac
atggaggatctgcaatccctcacaaagagaactccgatagtcaaggccaaacgtaccaca
aaagctggagagcgtgggccaaactctagaaagaaaaccaagaaagaagaggttggaaaa
actgaggcaataatgaagcagctgaaacaaggactttctcttcttcctttgatggagcct
tccattgcagctagtctggatttttttgctccttttggcagcagcccagccaatgccaag
gcccagttaaaaggctcatttggaaatgctatgctggacaatattccagactactattcc
caacttcttacaaagaacaacctcagcaatcctccaacaccaccatcatcacttcctcca
actccaccaccttctgtgcagcataagcttctaaacggagtgacactagcagaaggtcag
aaagagacagaggcatcagaggataccatgggttctgttccagaggaagtaaagagtgta
gacatactagcagctctccctactccacctcacaaccaaaatgaagatatacggatggag
agcgatgatgacagtgatgctccagacagcgttgtgcccgcatcctcacctgaaagccaa
ctaggtgatgagacaacacgcttcccccatctgttggatcccaaagaggaggaagatgag
agggccatctctcccgttatccccattattcctcgttctgccattccaagtttccccgag
acaaaaccgtttgagtcagtggatggaaaagttgtggcctcatccagccagtgggacaaa
accaaaaacaatgaagtgtctgtaactttcatgctttcatcagctgcggcaaagaatatc
aacacagtgatgttggctgttgcccaactgctgcacatacgtatgccaagttcctacgag
gcagcttttccccagagtccaggtagagcaggtgttggacctgggaaagtacctgacact
tccaacccaggtatgaaggcagacacttctgcaagccatgatgcagaatggcttaagcaa
tttgatgtttccctcccagggtgtaccctgaggaaacaagttgatattcttgctctcatc
aaacaggaatgccaagagcaagaagatagacctgctcagcactgttacatgacgaacgtt
tcagatctggatgtgcgccacctgcctgtcattcctgttgaggtttctccacctccatca
ccatcaccacctccacccccatcatctgctgtagctgagccagaaaatatcactcaacct
gagcccaaacctgaaccagatgcaccagttcagactacatcatccccttccgcaagccca
agtgctcctgccaaaacggaatctattgttaaactggagtctcacagctccccagttaca
gtggagtctgaatctcaggagcctgtggtccttccccaagctgctccatcagaagaagaa
cagcctcctgctccagccagttctcctcttctagactcccccacaatggagatatccctc
aagcccatcaaacaccgtagcaggcctctttctgatgaagaagaagaacgacccaaggtt
aaaaaatggaagggtcttcgctggaagcgtctccagatagtcatcactattcgtaaggga
gggtctaagaaagagaacagccgtgaagtttccgagctcatggagcgcctccgcattacg
ctgaaaccagacaagatgccccgtgacaagcgcaagtgctgcttctgccatgaggaggga
gatggtgccacagatggtccagcacgcttgcttaacatcgatgttgatctgtgggtgcat
cttaactgtgctctgtggtccactgaggtgtacgagacccagggcggtgcacttattaac
gtggaggttgcccttcggcgtggactacgcacccgctgtgcctactgtcagaagacgggt
gctactaacagctgcaatcgtttgcgctgcccgaatgtttatcattttgcctgtgccatc
cgggcacgctgcatgtttttcaaagacaaaactatgctttgcacccagcacaagcttaaa
ggccccagtgaagaggagcttagcagttttgctgtttttcgacgcgtctacatcgaacga
gatgaggtgaagcagattgcaagcatcctacaacgtggtgaccgtattcacatgttccgt
gttggcgggctcatcttccatgccgtgggccagctcttgccctgccagatggttgtgttt
cactcaccaactgctatctttccagtgggctacgaggccacacgcatttactggagcact
cgtgtgccaaaccgcagatgtcgctaccgatgtcgtatcagtgagcaggacggcaggccc
ctgtttgaagtgcgtgtgctggagcacgggtatgaagacctgcacttccgagacaccact
ccagatggaatttggtccaagattgtgcagcaggttgccaagctgcgtgatgaagcagcc
atgttgaaactcttcaccgagcatgtcaaaggagaagagatgtatggactcactgtccac
gcagtgatgcgaatcactgaatcgcttcctggtgtggaaaactgtcagaattatacgttc
cgatatggccgccatcctctcatggagcttccactcatgatcaatcctacaggctgtgca
cgatcagaacccagagttctcacccactgcaaaaggcctcatactctgaacagcacgagt
atgtccaaagcctatcagagcacatttacaggagagatcaacaccccatacagcaagcag
tttgttcattccaaatcttctcagtatcgtcggttgaagacagagtggaagaacaatgtg
tacctggcccgttctcgcattcaaggactgggtctgtacgctgctaaagaccttgaaaaa
cacaccatggtcattgagtacattggaaccatcattcgcaacgaggttgcaaatcgcaga
gagaagatttacgaggagcagaaccgtgggatctacatgttccgcattaataacgagcat
gtgattgatgccaccttaactggcggtcctgcccgttatgtcaatcattcgtgtgcaccc
aactgtgtcgcggaagttgtgacgtttgacaaagaggacaagatcatcatcatttctagt
cgcaggatcccgaagggtgaagagctgacgtatgactatcagtttgacttcgaggacgat
cagcacaagatcccctgccattgtggagcctggaattgcagaaagtggatgaactaa

DBGET integrated database retrieval system