KEGG   Sinocyclocheilus anshuiensis: 107698138Help
Entry
107698138         CDS       T04917                                 

Definition
(RefSeq) lysophospholipid acyltransferase LPCAT4-like
  KO
K13512  lysophospholipid acyltransferase [EC:2.3.1.23 2.3.1.-]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00564  Glycerophospholipid metabolism
sanh00565  Ether lipid metabolism
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107698138
   00565 Ether lipid metabolism
    107698138
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sanh01004]
    107698138
Enzymes [BR:sanh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     107698138
    2.3.1.-  
     107698138
Lipid biosynthesis proteins [BR:sanh01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   107698138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyltransferase EF-hand_7 EF-hand_6
Motif
Other DBs
NCBI-GeneID: 107698138
NCBI-ProteinID: XP_016354556
LinkDB All DBs
Position
Unknown
AA seq 514 aa AA seqDB search
MMMMMMKTHPFAYEVNVTAAQRIRGIILGVVLFPVRITLATLFFLLMWPIARLRLAGLSE
AERAEPVRGWRRWLFHHIMLLLSRAVFFSVGFLWIRVKGRQARLKEAPVLVVAPHSGFLD
MLVLCATGLPMVVSRSENCRLPVIGALLEFNQSVLVSRKDPESRKKCVSQICERVTSDGR
WPQMLMFPEGTTTNGRALIKFKPGAFLAGVPVQPVLLHYPGEPDTVRWTWKGLTWLGTLW
HTTSQIYTSVTVEFLPIYTPSQEEKQNPDLYAENIQKLMAKALRVPATDYVMEGRFPVKK
LGNLSLPLEPPAQETLKLLREHGLTNARVETVMNNVIDSCHSGQSTIVTADHLTTLLGLK
DRKTAVKICSLYSKDDTVDLRQVCLSVSAVSGFRSLESLIHTVFTWYDSDQDGLLSAGDL
SGLMGALVGIPQYEVEEMYSALTTRGRPTEASLQDLLMMHPVYRKVLHEYLHSSGLADGN
HNGIPNGNNNGIYSVSPPTAQALTSMDCERKRMS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgatgatgatgaagacgcatccgttcgcgtatgaagtgaatgtaacagcagct
cagcggattcggggaatcattctgggcgtcgttctgtttcctgtccgcatcaccctcgcc
accctcttcttcctgctcatgtggcccatcgctcggctgcgactggccggtctgtcggag
gcggagcgggcggagcctgtgcggggctggcgtcggtggctcttccatcacatcatgctc
ttactcagccgcgccgtcttcttctccgtgggcttcctgtggattagggtcaaagggcgt
caggcgagactgaaggaagcgccagttttagtcgtagcgcctcacagcggcttcctggac
atgctggtgctttgcgcgacgggtctgccgatggtcgtgtcgcggtcggagaactgcaga
ctacccgtcataggagcgctgttggagttcaatcagtctgtgttagtgagtcgaaaagat
cctgaatccaggaagaaatgtgtgtctcagatctgtgagagagtcacgtctgacggccgc
tggcctcagatgctcatgtttccagaaggaacgacgactaacggccgagctctgatcaaa
ttcaaacctggagcgtttctggccggtgttcccgttcagcccgtcttgcttcactatccc
ggtgaaccggacacggttcgctggacctggaaaggactgacgtggctcggcactctgtgg
cacaccacctctcagatctacaccagcgttaccgtggagttcctgcccatctacacgccg
tcacaggaggagaagcagaacccggacttgtacgccgaaaacatacagaaactcatggcc
aaagctctgcgtgttcctgccaccgattatgtgatggagggtcgatttcctgttaaaaag
ctcggaaacctctcgcttcccctggagcctccggcacaggaaacactcaaactgctccgt
gaacacggtctcactaacgctcgtgtggagaccgtgatgaacaacgtgattgacagctgt
cactcaggccagagcaccatagtaacggccgatcacctgaccactcttttggggctcaag
gacagaaagacggcggtgaagatctgctcgctttactcaaaggatgatacggtggatctg
aggcaggtttgtctgagtgtttctgccgtttctgggttcaggagtctggagtctctcata
cacactgtgttcacgtggtacgactctgaccaggacgggctgctgagcgcgggagatctg
tccggtctgatgggggcgctggtgggcatccctcagtacgaggtggaagagatgtactcc
gcgctgaccaccagggggcgaccgactgaagcttctctgcaagacttgctgatgatgcat
ccagtttatcggaaagtccttcacgagtatctccactccagcgggcttgcagacggaaat
cacaatgggattcccaacgggaacaacaacgggatttatagcgttagccctccgactgcg
caagcattaactagcatggactgtgagcgcaagagaatgtcatag

DBGET integrated database retrieval system