KEGG   Sinocyclocheilus anshuiensis: 107698381Help
Entry
107698381         CDS       T04917                                 

Definition
(RefSeq) prostaglandin G/H synthase 2-like
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00590  Arachidonic acid metabolism
sanh01100  Metabolic pathways
sanh04370  VEGF signaling pathway
sanh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107698381
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107698381
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107698381
Enzymes [BR:sanh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107698381
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 107698381
NCBI-ProteinID: XP_016354858
LinkDB All DBs
Position
Unknown
AA seq 606 aa AA seqDB search
MNSLVLFILLHLGFMVCQGANPCCSQPCQNRGVCTALGSDSYECDCTRTGYYGQNCTTPE
FLTWVKVSLKPSPNTVHYILSHFKSLWNIVNNVSFLRNGIMRYVLTSRAHLIDSPPIFNA
DYGYKSWEAYSNLSYYTRTLPPVPHDCPTPMGVAGKKELPDVKLLAEKLLLRRKFIPDPQ
RTSLMFAFFAQHFTHQFFKTDMKKGPAFTRALNHGVDLGHIYGQDLERQHKLRLFKDGKL
RYQVLDGEVYPPTVSEVQVDMHYPPHVPESRRFAVGHEAFGLVPGLMMYATIWLREHNRV
CDILKQEHPDWDDERLFQTARLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNERFQ
YQNRISSEFNTLYHWHPLMPDEFHVQDEVYNYKQFLFNTSILTDYGVNSLVESFTKQIAG
RVAGGRNVAPAVLKVAIKSIEDSRQIRYQSINAYRKRFNMKPYKSFEEMTGEKEMAAELE
ELYGDVDAVELYAGLLVEKPRTNTIFGETMVEMGAPYSLKGLMGNPICSPEYWKPSTFGG
KVGFEIVNTASLQKLVCNNVKGPCPMASFYVPNVKDSVPTTINASTSHSDQNVNPTVLLK
ERTSEL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtttggtattatttattcttttgcacctggggttcatggtttgccaaggagcc
aacccctgttgctctcagccatgtcagaatcgaggtgtctgtacggcattgggctcagac
tcgtatgaatgtgactgtacacgcactggatattacggtcaaaactgcacaacacctgaa
tttctcacatgggtgaaagtttctctgaagccttctcccaacacggtgcattatattctc
tcacacttcaaaagcttgtggaatattgtcaacaacgtgtcgtttttgagaaacggcata
atgagatacgtgctaacatctcgtgcccatctgattgatagccctcctatattcaatgct
gactatggttacaaaagctgggaagcctactcaaatctctcctactacactcgcacgctg
cctcctgtcccgcacgattgtccaacaccaatgggagtcgcaggaaagaaagagctgcca
gacgtgaagcttctggctgagaagctgcttctcaggaggaagttcataccagaccctcaa
cgcaccagtcttatgttcgctttctttgcccaacattttacacaccagttcttcaaaacc
gacatgaagaaaggtccagccttcacaagagccctgaatcacggggttgacttgggacac
atatacggacaggaccttgaacgccaacacaagctgagacttttcaaggatggcaagctg
agatatcaggttctggatggtgaggtttatcctccgacagtcagtgaggttcaagtagac
atgcactaccctcctcatgtacctgagtcccgtcgctttgccgttggtcacgaagccttt
ggactggttcccggactcatgatgtatgccaccatatggctgcgtgaacacaaccgagtg
tgtgatatactaaagcaggagcatcctgactgggatgacgagaggctgtttcagaccgca
cggctcatccttattggcgagacgatcaaaattgtcattgaagattatgtgcaacatctc
agtggataccactttaagctcaagtttgatcctgaacttctcttcaatgagcgtttccag
taccagaacaggatctcttctgagttcaacactctttaccactggcacccccttatgcct
gatgaatttcacgtccaggatgaagtctacaattataagcagtttctcttcaacacatct
atactgacagactatggtgtcaacagcttggttgagtccttcaccaaacagattgctgga
agggtggctggagggcgtaatgttgcaccagctgtgttaaaggtggccataaagtcaatt
gaagacagcaggcaaattcgctaccaatctatcaatgcctacaggaaacgcttcaacatg
aagccatacaaatcctttgaagaaatgacaggagaaaaggagatggctgctgaacttgaa
gagttgtacggggatgtggatgctgtggagctttatgctgggctgctggttgagaagccc
aggaccaacaccatctttggggagaccatggtggaaatgggtgccccctactccctcaaa
ggacttatgggaaatcccatctgttcccccgagtactggaaaccaagtacctttggtggc
aaagtgggctttgagattgtcaatactgcctctctgcagaaattggtttgcaataatgtc
aaagggccctgccctatggcgtccttctacgtgcctaatgtaaaagattcagtaccaacc
accattaatgcaagtacttcccactcggatcaaaacgtcaacccaacagttttactgaaa
gaacggacatctgaactctga

DBGET integrated database retrieval system