KEGG   Sinocyclocheilus anshuiensis: 107700161Help
Entry
107700161         CDS       T04917                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1-B
  KO
K11421  [histone H3]-lysine9 N-trimethyltransferase SETDB1 [EC:2.1.1.355]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107700161
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sanh03036]
    107700161
Enzymes [BR:sanh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     107700161
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107700161
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107700161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Tudor_4 DUF5604 TUDOR_5 Pre-SET MBD DUF4537 DUF745
Motif
Other DBs
NCBI-GeneID: 107700161
NCBI-ProteinID: XP_016357186
LinkDB All DBs
Position
Unknown
AA seq 1185 aa AA seqDB search
MELDPELEEELGVSLDELRKWIEEQVDSSEAVQQRKAQLEQLQEWVEQREKEVTNMDALC
SNASESVVQCEALVKEVYSNMGLVYRESSSEDEGGGRANPSEVIEIDDDDDDDVIAVGCV
VPPKKVVTPAKDSAFKEASAALQRTSQQVQNLAQSVNRTAQSSITPAKAVAPSAQSHGTL
AVPAVFMSSGPRNAPTQPNPNLKQDNIKINMTLLGKKRTKTWHRGTLVAIKQVGNNLKYK
VKFENKGKSLLSGNHVAFDYHPTLERLFVGARVVARYKDGNQVWLYAGVVAEMPNSKNRM
RFLIFFDDGYASYVGLPELYPICRPLKKTWDDIEDASCKDFIEEYITSYPNRPMVLLKPG
QIIKTEWEGTWWKSRVEEVDGSLVKMLFLDDKRSEWIYRGSTRLEPMFNLKMNTANSQEK
KMTGQQRQRPNMGALRTKGPVVQYTSDNSASASSRPVAPQIPPVRPVAPGPPQPSRTESP
SLKSQMAKKSTGQVALQPRQVVTSDLQPKALIGTVHQTNSSRLFLLQSGPVHMLTPITPV
PHTLQTTVSTYTSERIPQEPSYQAPNDRLFYLTHNCTPDCLKRIRPTRPNLHRGRNPLLT
PLLYEFRRMTGRRRLNRKMSFHVIYKSPCGLSLRNMAEIQHYLFQTHCDFIFLEMFCLDP
YVLVDRRFQPQRPFYFIRDITGGREDIPLSCVNEIDNTPPPSVAYSKERIPEDGVFINTS
PDFLVGCDCTDGCRDKSKCSCHQLTLQATGCAPGGQINPNAGYHHKRLEECLPTGIYECN
KRCRCNPQMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDVAKGSFVCIYAGKILTDDFA
DKEGLEMGDEYFANLDHIESVENFKEGYESEAHCSDSEGSGVDMSRVKLPASSQHGQDDS
SEDSDDDKDEESNEDESDSSDDTFVKDTYYSTSSVWRSYTTRRQAKGIKEESQDSKDGLS
VSTGEERKPPPMPEETGKSKVASWLTNQSSTSANQSVKVEGGMKTEKKEVMTLSDSDDVQ
TISSGSDDNKEREKKTQAVVKRQVAVKSTRGIALKSHSLMVKTVGGGAGGGGSGPSHGQG
GGGGDSGPKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPW
VAFFASKRIRAGTELTWDYNYEVGSVEGKELLCCCGSTECRGRLL
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atggagttggatccagagttggaggaggagttaggagtgtctttggacgagctgcgcaag
tggatcgaggagcaggtggacagcagtgaagccgtgcagcagaggaaagctcagctggag
cagctgcaggaatgggttgagcagagggaaaaggaggttactaatatggatgctctttgc
tctaatgcttcagagtctgtggttcagtgtgaagctctggtgaaggaagtttacagtaat
atgggtctagtgtatcgtgagagcagctcggaggatgagggaggaggcagagcaaaccct
tctgaggtcattgagattgatgatgatgatgacgacgatgtcattgctgtgggatgtgtg
gttcctcccaagaaagttgtcactccagccaaggactcagcgtttaaggaggcttcagct
gctcttcaaagaacatctcagcaggtgcagaacctggcccaatctgtcaacagaacggcc
caatcgagtatcacaccagctaaagcagtggccccttccgcacaatcccatggtactctg
gctgttccagcagtgtttatgtcatcaggcccaagaaacgcgcccactcaaccaaaccct
aatttaaaacaggataatatcaagatcaacatgacacttttgggtaaaaaacgaaccaag
acgtggcatcgtggaacacttgttgcaatcaaacaagtggggaacaatttaaagtacaag
gtgaagtttgagaataaagggaagagtcttctctctgggaaccacgtggcatttgattac
cacccaacactggagagactgtttgttggtgcccgtgttgtcgccaggtacaaggatggc
aatcaagtctggctctatgcaggtgtagttgctgagatgcccaacagcaagaatcgtatg
aggtttctgatcttttttgatgatggttatgcctcatatgtgggcctgcctgagctctac
ccaatctgcagaccattaaaaaagacctgggatgatattgaggatgcatcatgcaaagat
ttcattgaggagtacatcacgtcgtatcccaacagacccatggtgctgctgaagccagga
caaatcataaagacggaatgggagggaacgtggtggaaaagccgtgtggaagaagtggat
ggcagccttgtcaaaatgctttttctggatgataagcggagtgagtggatttatcgtggc
tcaacaagactagaacctatgtttaatctgaaaatgaacacagctaacagtcaagagaag
aaaatgactggtcaacaaagacagcggcctaatatgggagcattgaggacaaagggacct
gtagtgcagtacactagtgacaacagtgcttctgcttccagtcggcctgtggccccacag
atcccaccagttcgtccagtggctcccggacccccacagccttcccgcacagagagtcct
agtttaaagagtcaaatggctaaaaagagcactggtcaggttgcactgcagcctcgtcag
gtcgtgacctctgacctccagcccaaagcactgatcggcactgttcaccaaactaattcc
tccaggctctttcttctgcagtctggacctgtgcatatgttgacgccaatcacaccagtc
ccgcatactttgcagacaactgtgtcaacctacacaagtgagcgtattcctcaggagcca
tcgtaccaggctccgaatgacagacttttctaccttacacacaactgcactccagactgt
ctaaagcgcatccggcccacccgccccaacctgcatcgaggacgtaacccacttcttact
ccattgctctatgagtttcgccgcatgactggccgcagacgccttaaccgcaagatgtca
ttccatgtcatctacaagtccccgtgtggcttgagtctgagaaatatggcagaaatccag
cactacctcttccagacacactgtgacttcatcttcttggagatgttctgtctggacccc
tatgtgctggtggaccgtcgattccaaccccagaggccattctacttcatccgggacatc
acaggcggtcgcgaagacattcccttgtcctgtgtgaatgagatcgacaacactcctccg
cccagtgtggcctacagtaaagagaggatcccagaagatggagtgtttattaacaccagc
ccagacttcctggtgggctgtgattgcactgacggctgcagagacaaatccaagtgttcg
tgtcatcagctgactctgcaggctacaggatgtgccccaggtgggcagatcaaccccaac
gctggataccatcacaagagactggaagagtgtctccctacagggatatatgaatgtaat
aagcgctgccgctgtaatccgcagatgtgcactaaccgcctggttcagcacggtttgcag
gtccgactgcagctctttaagacccaaaataagggctggggcattcgttgccttgatgac
gtagccaagggctcatttgtttgtatctatgcaggtaaaatcctgactgatgactttgct
gataaagaaggtttggaaatgggggatgaatactttgccaatctagaccacattgagagc
gtggagaactttaaggaaggttacgagagtgaggcccactgctctgacagcgagggcagc
ggggtggacatgagcagggttaaactacctgcttcctcccaacacggccaagatgattca
tctgaagacagtgatgatgacaaagacgaagagtctaacgaggatgagagcgacagctca
gacgacacatttgtgaaagacacatattactccaccagctcagtgtggaggagctacacc
acccgcagacaggccaaaggaataaaggaagagagtcaggacagtaaggatggactgagt
gtgtccacaggtgaggagaggaagccacctccgatgccagaggagactgggaagagtaaa
gtggcgtcttggctcaccaaccagtcttccacttctgcaaatcagagcgtcaaggtggag
ggagggatgaagactgagaagaaggaagtaatgaccctctccgacagtgatgatgtgcaa
actataagctcaggatccgatgacaacaaggagagggagaaaaagactcaggctgtggtg
aagaggcaggtggcggtgaagtccacgcgtggcattgctttgaagtcccacagtctgatg
gtgaaaacagtgggagggggtgcaggaggaggcgggtcaggcccatctcatggacaggga
ggtggcgggggcgacagtggccctaaaaacacccgccagttctatgatggggaggaatcc
tgttatatcattgatgccaaactggaggggaacctcggacgctacctcaaccatagctgc
agtcccaatctgttcgtccagaatgtttttgtggatactcatgatctccgcttcccctgg
gtggccttctttgctagcaagcgcatccgagcagggacggagctgacgtgggattataat
tatgaagttggcagtgtggaaggcaaggagcttctgtgctgctgtggatcaacagaatgc
agaggacgactgctgtaa

DBGET integrated database retrieval system