KEGG   Sinocyclocheilus anshuiensis: 107700520Help
Entry
107700520         CDS       T04917                                 

Definition
(RefSeq) pancreatic alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00500  Starch and sucrose metabolism
sanh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107700520
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     107700520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 107700520
NCBI-ProteinID: XP_016357686
LinkDB All DBs
Position
Unknown
AA seq 512 aa AA seqDB search
MKLLILTALLGLSLAQFNPNTRDGKTAIVHLFEWRWADIAAECERYLGPNGFGGVQVSPP
SESIVVTNPWHPWWQRYQPIGYNLCSRSGNENELRDMITRCNNVGVSIYVDAVINHMCGA
GGGAGTHSSCGSYFDANKKDFPTVPYSNLDFNDGKCNTGSGNIENYQDINQVRNCRLVGL
LDLALEKDYVRGKVADYMNKLIDMGVAGFRVDACKHMWPGDLSAVYGRLNNLNTMWFSSG
SRPFIFQEVIDLGGEPITSGEYTGIGRVTEFKYGARLGNVIRKWNGEKLSYVKNWGEGWG
FMSSDKSLVFVDNHDNQRGHGAGGASIVTFWDARLYKMAVAFMLAHPYGFTRVMSSYRWD
RNIVNGVDQNDWQGPPSNGDGSTKPVPINPDSTCGDGWVCEHRWRQIKNMVAFRNVVNEQ
AFSNWWDNGDNQVSFSRGNKGFLVINNDDWELNETLNTGLPGGTYCDVISGQKESGRCTG
KEVVVGGDGRASFRISNQEEDPFIAIHTDSKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttttaatcttgacagcgctgcttggactgagccttgctcagtttaacccaaac
accagagatggaaaaactgccatcgtccacctgtttgagtggcgctgggctgatatcgca
gcagagtgtgagcgctacctcggaccaaatggctttggtggagttcaggtatcccctcca
agtgaaagcattgttgtcacaaacccctggcacccttggtggcagagatatcaaccaatc
ggttacaatctgtgctccagatcaggaaatgaaaatgagctgagagacatgatcactagg
tgcaacaatgttggggtgagcatctatgttgatgcagtcatcaaccacatgtgtggagca
ggtggtggagccggtacccactcaagttgtggttcatattttgatgccaacaagaaggac
ttccccacagttccttactccaacttggacttcaatgacggcaaatgcaacactggcagt
ggaaacattgagaactaccaagatatcaatcaagtgagaaactgtcgtctggttggtctt
ctggacttggctttggagaaggactatgtgcgtggtaaggtggccgactacatgaacaag
ctgattgacatgggagtggctgggttcagagtggacgcctgcaagcacatgtggcccggt
gatctttctgctgtctatggccgtctcaataatctgaacacaatgtggttttcatctggt
tccaggccttttatcttccaagaggttattgatctcggtggggagcccattacatcaggc
gaatacactggaattggaagggtgactgagttcaagtatggtgccaggctgggcaatgtc
atccgcaaatggaatggagaaaaactgtcctacgtcaagaactggggtgaaggttggggc
ttcatgtcttctgataaatctctggtgtttgttgacaaccacgataaccagagaggacat
ggtgctggaggtgcatctattgtgacattctgggatgccaggctttacaaaatggctgta
gcctttatgttggcccatccatatggatttaccagagtaatgtccagctaccggtgggac
cgcaacatcgtgaatggagtggaccaaaatgactggcagggaccccccagcaacggtgat
ggatccaccaaacctgttcccatcaaccccgactctacctgtggagatggctgggtttgt
gagcacagatggcgtcagatcaaaaacatggtggccttccgtaatgttgtaaatgaacag
gcattctctaactggtgggacaatggagacaaccaggtctctttcagccgtggtaataaa
gggttccttgtcattaacaacgatgactgggagctgaacgagaccctaaacacgggtctg
ccaggaggcacctactgtgatgtgatctctggtcagaaggaaagtggcagatgtactggg
aaagaggtggtggttggaggagatggacgtgcttccttcagaatcagcaaccaggaagaa
gacccatttatcgccattcacactgactccaaactttaa

DBGET integrated database retrieval system