KEGG   Sinocyclocheilus anshuiensis: 107700590Help
Entry
107700590         CDS       T04917                                 

Definition
(RefSeq) mitogen-activated protein kinase 6-like
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sanh01001]
    107700590
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107700590
Protein kinases [BR:sanh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107700590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 107700590
NCBI-ProteinID: XP_016357795
LinkDB All DBs
Position
Unknown
AA seq 724 aa AA seqDB search
MAEKFESLMNIHGFDLGPRYIDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFETLGPSGRRLTEDVSSLTEVNSVYIVQEYMETDLCKVLE
QGLLSEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRLELQSVIPVFIKNDMSEPHTPLAKLLPGVSPEALDFLEKILTFN
PMDRLTAEEALAHPYMSDYSFPLDEPVSLHPFHIEDEVDDILLMDESHSHIYNWDRYHES
QFSDQDWHLHSTHELEDVQRDPRAMSDGTDEEEVQIDPRKYMDGECEKFLEDPSFDLPPE
RSWQQEDHHENKYCDQECSYTCNYKAVSPSYLDNLIWRDSEVNHYYEPKLIIDLSNWKEQ
QSKEKNDKKGKTKCEKNGLVKAQIALQNHCVAEKDREQEKHQNHNQGFDFDSFIASTIKM
SLQTESGDVDLLNELNTSVSQLDTRAPCGSMSKSISQEKEEKCLVNLAQLGVRAPCPWES
FTDSDVTDSSIIDEACWDVRKDEQLQKENSSCQSSYLDRLFNKREEVESEIPEPVEESTP
EDDFISCGGEIVFNMQLESLAIPGFEGAGDIPLKSIQATLTPSAVKRSPQIAHKTYSSIF
KHLN
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagccttatgaacattcacggcttcgacctgggccctcgctac
attgacctaaagcctctgggctatgggggcaacggactggtcttttccgccgtcgacacc
gattgtgacaaaagggtcgctgtgaaaaagattgtcctaaccgaccctcagagcgtcaaa
cacgcactgcgcgaaatcaagatcattcgcaggctcgatcacgacaacatcgtgaaggtg
tttgaaacgctggggcccagtggccggaggctcacggaggacgtgagctctctgacggag
gtcaactctgtgtacatcgtacaggagtacatggaaacagacctctgtaaagtgctggaa
cagggcttgttgtccgaggatcatgcacggctgttcatgtaccaactgctgcgaggactc
aaatacatccactctgcaaacgtgcttcaccgagacctgaagcctgccaacctcttcgtc
aacactgaggacctggtgctgaaaattggggactttggacttgcccgtatcatggacccc
cactattcccataaggggtatctgtctgagggactggtcactaaatggtatcgttctcct
cgtctgctcctttccccaaataactacaccaaagccattgacatgtgggccgcagggtgc
atctttgctgaaatgctgactggaaaaactctctttgcaggagctcacgagctggaacag
atgcagctgattctggaatccattccggtagtccatgaggaagacagactggagctccaa
agtgtaatacctgtctttatcaagaacgacatgtcagaaccacacacgccgctcgccaag
ttattgcctggtgtcagccctgaggccttggatttcctggagaagatcttgacgtttaac
cccatggaccggctcactgcggaagaggctcttgctcacccatacatgagcgattactcc
ttccctctagacgaaccagtgtccttgcaccccttccacatcgaggatgaggtggatgac
atcttgctcatggatgagagccacagtcacatctacaactgggacaggtaccatgaaagt
cagttctctgatcaagactggcacctgcacagcacccatgaactagaagacgtgcagcgt
gatcctcgagctatgtcagatggcacggacgaggaggaggtccagatcgatccacggaaa
tacatggatggggagtgtgagaagttcctagaggatccatcgttcgatcttccaccagag
cgctcgtggcaacaggaagaccaccatgagaacaaatactgtgaccaggagtgcagctac
acttgcaactacaaagctgtgtccccatcctacctggacaatctgatctggagggacagt
gaggtgaaccactactatgagcccaaactcatcattgacctctccaactggaaagaacag
caaagcaaagagaagaacgacaaaaaaggcaagaccaagtgtgagaagaacggactggtc
aaggcccagatcgccctgcaaaaccactgcgtggccgagaaggatcgcgaacaagaaaaa
caccagaaccacaaccagggcttcgactttgattcgtttatcgccagcaccatcaaaatg
agccttcagacagaatccggcgacgttgacctcctgaatgagttgaacacctccgtttcc
cagctggacacccgtgctccttgcggctccatgtccaagtccatcagtcaggagaaagaa
gagaagtgtctagtaaacctggcacagcttggcgtccgagcaccctgtccttgggagagt
ttcacggacagcgacgttaccgatagcagcataatcgacgaggcttgctgggacgtccgc
aaagacgagcagctccagaaggagaacagcagctgccagagcagttacttagaccgcctc
ttcaacaagcgtgaggaggtagagtccgagatccccgaacctgtcgaggagtccacaccg
gaggatgacttcatatcctgtggcggcgagattgtctttaacatgcagctggagtctctg
gccattccggggttcgagggagcgggtgacattcctctgaagtccatccaggccacgtta
acgccctctgctgttaagcgctccccacaaatcgcccacaaaacctacagcagcattttc
aagcatttaaattaa

DBGET integrated database retrieval system