KEGG   Sinocyclocheilus anshuiensis: 107701135Help
Entry
107701135         CDS       T04917                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107701135
Enzymes [BR:sanh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107701135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 107701135
NCBI-ProteinID: XP_016358563
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MAMKAVCVLKGTGEVTGTVYFEQQNETSSVELSGEITGLTPGKHGFHVHAFGDNTNGCIS
AGPHFNPYGKNHGGPTDSDRHVGDLGNVIADDNGVAKIGIEDKSATLLGQHSIIGRTMVI
HEKEDDLGKGGSEESLKTGNAGGRLACGIIGITQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaaagctgtttgtgtgctcaaaggcaccggggaagtgaccggaaccgtttat
ttcgagcagcagaatgaaacctcttcagtggagctctcaggtgaaatcactggccttact
ccaggaaagcatggtttccatgtccatgcttttggagacaacacaaatggctgcatcagt
gcaggtccacacttcaacccttatggtaaaaatcatggtggaccaactgatagtgacaga
catgtcggagaccttggtaacgtgatagccgatgacaatggtgttgcaaaaattggcatt
gaggataaaagtgcgaccctgttagggcaacactccatcattgggaggaccatggtgatc
catgagaaggaggatgacttgggtaaaggaggcagtgaagaaagtcttaaaactggcaat
gctggaggtcgcctggcctgtggaattataggcatcactcagtga

DBGET integrated database retrieval system