KEGG   Sinocyclocheilus anshuiensis: 107701824Help
Entry
107701824         CDS       T04917                                 

Definition
(RefSeq) histone deacetylase 6-like
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
sanh  Sinocyclocheilus anshuiensis
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:sanh01009]
    107701824
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:sanh03019]
    107701824
   04131 Membrane trafficking [BR:sanh04131]
    107701824
   03036 Chromosome and associated proteins [BR:sanh03036]
    107701824
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     107701824
Protein phosphatases and associated proteins [BR:sanh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107701824
Messenger RNA biogenesis [BR:sanh03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     107701824
Membrane trafficking [BR:sanh04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    107701824
Chromosome and associated proteins [BR:sanh03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     107701824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 107701824
NCBI-ProteinID: XP_016359436
LinkDB All DBs
Position
Unknown
AA seq 1088 aa AA seqDB search
MDPVPDSKRSTRSLRGTPETNRENNNPNHKKNLQEARRKGRMDRSKEEEEEMSNELQNLD
VRGKTKATGTGLVYVDAFTRFHCLWDASHPECPARVSTVMEMLETEGLLGRCVRVEARAV
SEDELLLVHTKEYAELMKSTQKMTEEELKTLADKYDSVFLHPEFFTSACLAVGSVLQLVD
KVMTSQLHNGFSVNRPPGHHAHADKMNGCCMFNHLAIAARYAQKQHGVKRVLIVDWDVHH
GQGIQYIFEEDPSVLYFSVHRYEDGSFWPHLKESDSSSVGSGAGQGYNINLPWNKIGMED
GDYITAFQQLLLPVAYEFQPQLVLVAAGFDSVIGDPMGEMRVSPQCFSILTHMLKGVAQG
RLVLALEGGYNLQSTAECVCASVRSLLGDPCPHLISPGVPSESALKSISKTISALYPFWK
SLQTFEGGPLSDVPPLPAPVCAEVKASSLITGLVYDQRMMLHHNMWDGHHPELPQRISRI
FCRHEELGLLSRCLWIPARLATEEELALCHSSEHISTIKSTEHMKPRDLHRLGNDYNSIY
ISNESYTCALMAAGSCFNSVQAILTGQVRNGVAIVRPPGHHAEKDTACGFCFFNTAALTA
RYAQCTTHESLRVLILDWDVHHGNGTQHIFEEDDSVLYISLHRYEDGTFFPSSEDANYDK
VGQGKGRGYNVNIPWSGGKMGDPEYLAAFHHIVMPIAREFAPELVLVSAGFDAARGDPLG
GYQVTPEGYAHLTHQLMSLAAGRVLVILEGGYNLTSISESMSMCTSMLLGDSPPSLDHLP
PPKTNATVTINNVLRALAPFWSSLRIQIPESLRLALPSPKPKGKRASAGKGKKSPRQSTP
AQSPGQTPQHLEQSGLDELSKDLLSLNLNTSTSSNPSPASIPIGGARRKVKPTPQRDSAD
RESDSPLKLKSEKTRAGDDTHAEITTDRTIPESVVTGNSAAVDDQENSVLEAAGGQATMM
SVLESVFGAQATDLDTMYAVDPLPWCPHLESVRPVPAGGIDVFLPCEECGGDTENWICLF
CYKVLCGRYVKQHMVTHGQVSGHPMVLSFADLSVWCYACESYVHNKVLHEAKNTAHLVKF
GEEIPPFN
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atggatcctgttccagattccaaacgttctactcgatcactaagaggaacaccagaaacc
aatagagaaaacaacaatccaaaccataagaagaatctacaggaggcgcggaggaagggc
agaatggatcggagcaaagaggaggaggaggagatgagcaatgagctccaaaacttggat
gttcgtggtaagactaaagcaacaggaacaggtctcgtctacgtagacgcctttactcgc
tttcactgcctctgggatgccagtcacccagagtgtccagcgagagtgagcactgtgatg
gagatgctggagacggaaggtctgctgggacgctgcgtacgagtagaggccagagctgtg
tcagaagatgagctgttactcgttcatacgaaggagtatgcagagctgatgaaatccact
cagaaaatgacagaggaggagctgaagactctggctgataaatatgactctgtcttcctg
catcctgaatttttcacctctgcctgtctggcagtgggatcggttctccagctggtggat
aaggtgatgacatcacagctgcataacggcttctccgtcaacaggcctcctggtcaccac
gctcatgcagataagatgaacggctgctgtatgtttaaccatctggccatagcagcgcgc
tacgctcagaaacagcatggagttaaacgagttctaattgtggattgggatgtgcatcac
ggacagggaatccaatatatttttgaagaggatcccagtgtgctgtatttctcagtgcac
agatatgaagacggctcgttctggccgcacctcaaggagtctgacagcagttcggtgggt
tcaggagcaggacagggctacaatatcaacctgccctggaacaagataggaatggaggat
ggagattacatcacagctttccagcagctactcctgcctgtggcgtatgagttccagcct
cagctggtgttagtggcggccggatttgactctgtgatcggtgacccaatgggtgagatg
cgagtgagtccacagtgcttctccatcctgacccacatgctgaaaggtgtagcacaggga
cgacttgtgctggctcttgagggtggatataacctccagtccacagcagagtgtgtttgt
gctagtgtgaggtcactgctgggtgacccttgccctcatctgatctctcctggtgttccg
agtgaaagtgccctgaagtccatctcaaagaccatctcagccttgtatccattttggaag
agtcttcagacgtttgagggtggtcctctgtccgatgtccctcccctgcccgctccagtg
tgtgcagaagtgaaggcttcctctctgatcactggactagtttacgaccagagaatgatg
cttcatcacaacatgtgggatggtcatcatccagagctccctcagagaatttcacgcatc
ttttgccggcatgaggagttgggtctgctgtcccgttgcctttggataccagctcgccta
gcaacagaagaagagctggcactctgtcacagttctgagcacataagcactataaagagt
acagagcacatgaagcccagagatctgcacagactgggaaacgattacaactccatctac
atcagtaatgagagctacacctgtgccctgatggccgctggctcgtgttttaactccgta
caggccatactcacaggccaggtgagaaacggcgtggccatagtccgtcctcctggtcat
catgcagagaaagacacagcttgtggtttctgtttctttaatacggccgctttgaccgca
cgctatgcccagtgcaccactcacgagtccctgcgcgtcctcatcctcgattgggatgtt
catcatggaaacggcacacagcacatctttgaggaggatgacagtgttctgtacatctct
ctgcatcgctacgaagacggtacattcttccccagttcggaggatgctaactatgataag
gtggggcaagggaaaggcagaggatacaatgtcaacatcccctggagtggaggaaagatg
ggagacccagaatacttggcggctttccatcacatagtgatgccgatagccagagagttt
gccccagagctggtgctggtgtctgctgggtttgatgcagcacgaggtgatccgttagga
gggtatcaggtgaccccagagggctacgcccacctcacccatcagttaatgagtctggct
gcaggaagagtgctagtcatactggagggaggatataacctcacctccatctctgagtca
atgtccatgtgcaccagtatgttgctgggagactctcctccatctctagaccatctgcca
cctccaaagaccaatgccactgtcacgattaacaatgtcctgcgtgctctcgcccccttc
tggagctccctgagaatacagattccagagtcacttcgtttggctttgccatctcctaaa
ccgaaaggcaagcgggcatcagcgggcaagggcaagaaatctcctcgccagtccacccct
gcccaaagtcctggacagacaccgcagcatcttgagcagtccggccttgatgagctcagt
aaggacctgctctctctgaatctcaacacgagtacctcatctaaccccagcccagcttca
atccccatcggaggagccagacggaaggtgaaacccaccccacagagggattcagcagac
cgggagtcagattcacccctaaaactcaagtcagagaaaaccagagctggagacgacacg
catgcggagattacgacggaccggacgatcccagagtctgtggtcactggaaattcagct
gccgtggatgaccaggagaactccgtgctggaggctgctggtggtcaagccactatgatg
tcagtcttagaaagtgtctttggagcacaagccacggatttggacaccatgtatgcggtg
gacccgttgccatggtgcccacacttggagtcagtgcgaccggtgcctgcaggtggcatc
gatgtcttcctgccgtgtgaagagtgtggaggtgatacagaaaactggatctgcctcttc
tgctacaaggtgctctgcgggcgttatgtgaagcagcacatggtgacccacggacaggtg
tcgggtcaccctatggtgctgagcttcgctgacctctctgtctggtgctacgcttgtgag
tcatacgtccacaacaaggtgctccatgaagccaaaaataccgctcacctcgtgaagttt
ggagaggagattcctcctttcaactaa

DBGET integrated database retrieval system