KEGG   Sinocyclocheilus anshuiensis: 107702495Help
Entry
107702495         CDS       T04917                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00052  Galactose metabolism
sanh00500  Starch and sucrose metabolism
sanh01100  Metabolic pathways
sanh04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107702495
   00500 Starch and sucrose metabolism
    107702495
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107702495
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sanh04147]
    107702495
Enzymes [BR:sanh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107702495
Exosome [BR:sanh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107702495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N DUF5110 Trefoil Gal_mutarotas_2 FluMu_N GHL15
Motif
Other DBs
NCBI-GeneID: 107702495
NCBI-ProteinID: XP_016360329
LinkDB All DBs
Position
Unknown
AA seq 942 aa AA seqDB search
MVSYKRLTPEEVHFSGAALLDPDESTDMDLKEEHPELPLLPQSPRCSITIALLTLGGLIV
VLSGVWLLGTIFWLHKPPSTEPHRPPPPAVGRSPNGTWLQPESCSQIPEAWRFDCYPERG
VVVTAEMCHARNCCFIQNSQAKTSGWNGVPWCFYTPEYPSYELVSITDTEIGKVGKLLRN
KKTYYPKDIDALQLEVLYEDNRLHVKITDPAEKRYEVPIDVPVVPKTASSNPSYTVDFIK
EPFGLIVKRTQTGTVLLNTSIAPLFYADQFLQMSTSLPSRFIYGLGEHRSNFLHDLQWNT
LTMWARDVPPMELTNLYGVHPFYLSMESDGMAHGFFMLNSNAMDVALQPAPALTWRMIGG
ILDFYVFLGPDPSSVIAQYLDVVGKPAMPIYWALGYHLCRWGYKSSDKTWNVVKEMRNYG
IPQDVQWNDIDYMDSALDFTYDTMNFSTLPDLVKDLHKHDQHYVMILDPGISNSLPSGSY
WPFDEGKKRGIFINDSNGDILTGKVWPGLTAFPDFSNPDTHEWWYQNLKSFHEKVPFDGV
WIDMNEPSNFFDGSLNGCPENELENPPYTPGILGGTLKAKTVCASARQKISTHYNIHSLY
GLMEAKATESALRKITDKRPFVISRSTFPSQGKYSGHWLGDNRSQWKDLATSIPGMLTFN
ILGIPLIGADICGFGGSTTEELCVRWTQLGAFYPFSRNHNSIDEQENFLPSRPNTTLWVS
SGQPLNLIVSLSEDGLAKGDLYWDDGETLDTYEKDQYAYIYFTVEQRGMLTFNILGIPLI
GADICGFGGSTTEELCVRWTQLGAFYPFSRNHNSIDEQRPNTTLWVSSGQPLNLIVSLSE
DGLAKGDLYWDDGETLDTYEKDQYAYIYFTVEQNTMTSEVLHNHEEAAYITVETVSFYGV
KVEPENVTVNSQEAAFTYHDNQVLTVTDLGLNLSRNFTINWM
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgtacaagagactcacccctgaggaagttcatttctcaggagccgcgttgttg
gatcctgatgagtcgacggacatggatctgaaggaagaacacccagaactgcccctgctg
ccccagagccctcgctgctccatcaccattgccctgctgacccttgggggacttattgtg
gttctctctggtgtctggctgcttggaactatattttggttacataagccaccctccaca
gaacctcatagaccccctccacccgctgtgggtagaagcccaaacgggacgtggctgcag
ccagagtcctgctcgcagattccagaagcttggaggtttgactgttatccagagagaggt
gtggtggtcacggcggagatgtgccatgctcgaaactgctgcttcatacagaactcacag
gctaagacatcgggatggaatggagtgccctggtgtttctacacacctgaatatccatcc
tatgagctggtgtccattactgacactgagatcgggaaggttggaaaactgctccggaac
aaaaaaacatattatcctaaagacatagatgcactgcagctggaggtgctgtatgaggac
aacagactgcatgtgaagataacagacccggctgaaaagaggtatgaggtgcctatagat
gttcctgtggttccgaaaacagcatcatcaaacccctcttacactgtagacttcatcaaa
gaaccttttgggctgattgtcaagagaacacaaacaggaactgtactgctgaatacatcc
atagctcctctcttctacgcggatcagtttctgcagatgtccacatcattaccatcacgt
ttcatatatggactgggtgaacatcgctccaactttctgcatgacctccagtggaacact
ctcaccatgtgggctcgagatgtcccacccatggagctgaccaacctctatggcgtccat
cccttttatctttccatggaatctgatggaatggcacatgggtttttcatgctcaacagc
aatgcaatggatgtggctctgcagcctgctcctgctctcacctggcgtatgattggtggg
atccttgacttttacgttttcctaggcccggatcccagctctgtgattgcacagtacttg
gatgttgtagggaagcctgcaatgcccatctactgggctctgggctatcatctctgccga
tggggctacaagtcaagcgacaaaacatggaatgttgtaaaagaaatgcgtaattatggg
atacctcaggatgttcagtggaatgacattgactacatggatagtgctttagatttcact
tatgacactatgaacttttccacccttcctgaccttgtgaaagaccttcataaacatgat
caacactacgttatgatcctggatcccggaatcagtaactctctgccgtctggctcctac
tggccatttgatgaggggaagaagaggggcatcttcatcaatgattcgaatggagacatc
cttaccgggaaggtctggccaggactcacggcctttccagatttctccaatccagacaca
catgaatggtggtaccagaatctgaagagtttccatgaaaaagtgccttttgatggcgtg
tggattgacatgaatgaaccatctaatttttttgatggatcactgaatggttgtcctgag
aatgaactggaaaatcctccctacaccccagggattctgggtggtacattaaaggctaag
actgtgtgtgcatctgcacgtcagaaaatctccactcactacaacatacacagtctgtat
ggactcatggaggctaaggcaactgaaagtgctttgaggaagatcacagataagcgtccc
ttcgtcatttcccgctctacgtttcccagtcagggcaagtattcaggccactggctcgga
gacaacaggagccaatggaaagacctggccacatccatacctggtatgctgacatttaac
atcctgggcattcctcttattggggcagacatctgtggctttggaggcagcactacagaa
gaactatgtgtccgatggacccagcttggagctttctaccccttttcaagaaatcacaac
tccatagatgaacaggagaactttcttccatctagacctaacaccaccctgtgggtgagc
agcggtcagccccttaatctgattgtgagtctgagtgaggacggcctggccaagggtgat
ttgtattgggatgatggagagacccttgacacttatgagaaagatcaatatgcttacatc
tatttcacagtagaacagcggggtatgctgacatttaacatcctgggcattcctcttatt
ggggcagacatctgtggctttggaggcagcactacagaagaactatgtgtccgatggacc
cagcttggagctttctaccccttttcaagaaatcacaactccatagatgaacagagacct
aacaccaccctgtgggtgagcagcggtcagccccttaatctgattgtgagtctgagtgag
gacggcctggccaagggtgatttgtattgggatgatggagagacccttgacacttatgag
aaagatcaatatgcttacatctatttcacagtagaacagaatacgatgacatcagaggtg
ctgcataatcatgaagaggctgcttacatcacagtggagaccgtttccttttatggggtg
aaggtggagccagaaaacgtaaccgtgaattcacaagaggcggcgttcacttaccatgac
aatcaggtgctgacagtaacagacttgggtctgaacctcagtcgtaacttcacaatcaat
tggatgtaa

DBGET integrated database retrieval system