KEGG   Sinocyclocheilus anshuiensis: 107703174Help
Entry
107703174         CDS       T04917                                 

Definition
(RefSeq) glucokinase-like
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
sanh  Sinocyclocheilus anshuiensis
Pathway
sanh00010  Glycolysis / Gluconeogenesis
sanh00052  Galactose metabolism
sanh00500  Starch and sucrose metabolism
sanh00520  Amino sugar and nucleotide sugar metabolism
sanh00524  Neomycin, kanamycin and gentamicin biosynthesis
sanh01100  Metabolic pathways
sanh01200  Carbon metabolism
sanh04910  Insulin signaling pathway
Module
sanh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sanh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sanh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107703174
   00052 Galactose metabolism
    107703174
   00500 Starch and sucrose metabolism
    107703174
   00520 Amino sugar and nucleotide sugar metabolism
    107703174
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107703174
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107703174
Enzymes [BR:sanh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     107703174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 107703174
NCBI-ProteinID: XP_016361210
LinkDB All DBs
Position
Unknown
AA seq 476 aa AA seqDB search
MPCLTSARRQGMLSDFESVLERILMVEQILSEFLLSKEDLEEVMRRMRREMERGLRVETH
NEASVKMLPTYVRSTPEGSEVGDFLALDLGGTNFRVMLVKVGEDEERGWKVETKHHMYSI
PEDTMTGTAEMLFDYIAGCISDFLDKHNLKHKKLPLGFTFSFPVRHEDLDKGILLNWTKG
FKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHSCEVGMIVGTGC
NACYMEEMRKVELVEGEEGRMCVNTEWGAFGDNGELEDFRLEYDRVIDETSLNPGHQLYE
KLIGGKYMGELVRLVLLKLVNENLLFNGEASDLLKTRGAFETRFVSQIESDTGDRKQIYN
ILSTLGILPSELDCDIVRLVCESVSTRAAHMCGAGLAGVINLMRERRCQEQLKITVGVDG
SVYKLHPHFKERFHKLVWEINPHCEITFIQSEEGSGRGAALISAVAYKMATCMLTP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgccttacttcagctcgtaggcaagggatgctgagtgactttgagtcagtactg
gagagaattctcatggtggaacaaattttgtccgaatttctgttgagtaaagaagatcta
gaggaagtgatgaggagaatgcggagagagatggagaggggactgcgagtggagacacac
aatgaagccagcgtcaaaatgctgcccacttatgtccgctccacacctgaaggctctgag
gttggtgatttcctggcactggatcttggagggacaaactttcgagtgatgctggtgaaa
gtgggtgaggatgaagagcgcggctggaaggtggagacgaagcatcacatgtactccatt
cctgaagacaccatgactggcacagctgaaatgttgtttgattacattgccggctgcata
tctgacttcctggacaaacataatctgaaacataagaagcttccactgggattcaccttc
tcatttccagtccgtcatgaggatttagacaagggcattctgcttaactggactaaaggc
ttcaaggcctctggcgctgagggaaataacgttgtgggtctgctgagagacgccattaaa
agaagaggggactttgaaatggatgtggttgccatggtgaatgacacagtagccacaatg
atctcctgctactatgaagaccacagctgtgaagttggcatgatagtaggtaccggctgt
aatgcgtgttatatggaggagatgcgtaaggtggagctggtggagggagaggaggggagg
atgtgtgtgaacacagagtggggagcgtttggggacaatggtgaactggaggacttccgg
ctggagtatgatcgcgttattgatgagacatcactaaaccctggacatcagctgtatgag
aagctgattggtggaaagtatatgggggagcttgtgcgtcttgtgctgctaaaactagtg
aatgaaaatctgctgtttaacggcgaagcctcagacctgctgaaaacacgtggagctttt
gaaactcgcttcgtctcccagattgagagtgacacaggggacagaaagcagatctacaac
atcctaagcacactgggaatcttaccatcggagctggactgtgacattgtgcgtctggtc
tgtgagagcgtgtctacgcgagccgctcacatgtgcggggccggcctcgctggcgtcatc
aacctaatgagggaacgccgctgtcaagagcaactgaagatcactgtgggagtcgatggc
tctgtctacaaactacaccctcatttcaaggagcggttccataagcttgtgtgggaaatt
aatcctcactgcgaaattaccttcatccaatcagaagaggggagcggtcggggcgcggct
ctcatttccgctgtggcatacaagatggccacctgcatgctgacaccgtga

DBGET integrated database retrieval system